BLASTX nr result
ID: Ophiopogon26_contig00019176
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019176 (719 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX51797.1| Ccl1p [Rhizophagus irregularis DAOM 197198w] >gi|... 155 8e-42 gb|PKC03438.1| cyclin-like protein [Rhizophagus irregularis] 154 2e-41 gb|PKK64788.1| cyclin-like protein [Rhizophagus irregularis] 145 4e-38 gb|PKY31229.1| hypothetical protein RhiirB3_448727 [Rhizophagus ... 60 3e-08 gb|PKC53543.1| hypothetical protein RhiirA1_479089 [Rhizophagus ... 60 4e-08 gb|PKY48292.1| hypothetical protein RhiirA4_463850 [Rhizophagus ... 63 8e-08 gb|PKC59258.1| hypothetical protein RhiirA1_469727 [Rhizophagus ... 63 1e-07 gb|PKB97353.1| hypothetical protein RhiirA5_433305 [Rhizophagus ... 63 1e-07 gb|EXX63517.1| hypothetical protein RirG_151660 [Rhizophagus irr... 63 1e-07 gb|PKY46166.1| hypothetical protein RhiirA4_460975 [Rhizophagus ... 62 1e-07 gb|ORY00404.1| cyclin-like protein [Basidiobolus meristosporus C... 61 4e-07 gb|EXX67675.1| hypothetical protein RirG_112320 [Rhizophagus irr... 58 7e-07 gb|POG73100.1| hypothetical protein GLOIN_2v1772856 [Rhizophagus... 58 3e-06 >gb|EXX51797.1| Ccl1p [Rhizophagus irregularis DAOM 197198w] dbj|GBC12992.1| Cyclin protein kinase [Rhizophagus irregularis DAOM 181602] gb|PKC59060.1| cyclin-like protein [Rhizophagus irregularis] gb|PKY29645.1| cyclin-like protein [Rhizophagus irregularis] gb|PKY51186.1| cyclin-like protein [Rhizophagus irregularis] gb|POG73507.1| cyclin-like protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 355 Score = 155 bits (391), Expect = 8e-42 Identities = 75/75 (100%), Positives = 75/75 (100%) Frame = -3 Query: 630 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDADHHKKK 451 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDADHHKKK Sbjct: 281 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDADHHKKK 340 Query: 450 RIEDEYQKSLEEVFK 406 RIEDEYQKSLEEVFK Sbjct: 341 RIEDEYQKSLEEVFK 355 >gb|PKC03438.1| cyclin-like protein [Rhizophagus irregularis] Length = 355 Score = 154 bits (388), Expect = 2e-41 Identities = 74/75 (98%), Positives = 75/75 (100%) Frame = -3 Query: 630 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDADHHKKK 451 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDADHHKKK Sbjct: 281 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDADHHKKK 340 Query: 450 RIEDEYQKSLEEVFK 406 +IEDEYQKSLEEVFK Sbjct: 341 KIEDEYQKSLEEVFK 355 >gb|PKK64788.1| cyclin-like protein [Rhizophagus irregularis] Length = 351 Score = 145 bits (366), Expect = 4e-38 Identities = 72/75 (96%), Positives = 73/75 (97%) Frame = -3 Query: 630 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDADHHKKK 451 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSA+ KRKLEREGLEDADHHKKK Sbjct: 279 LDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAM--KRKLEREGLEDADHHKKK 336 Query: 450 RIEDEYQKSLEEVFK 406 RIEDEYQKSLEEVFK Sbjct: 337 RIEDEYQKSLEEVFK 351 >gb|PKY31229.1| hypothetical protein RhiirB3_448727 [Rhizophagus irregularis] Length = 77 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 45 AISPTDTCDNINTVWLYHFLREAKSLFNQET 137 +ISPTDTCD+I+T+W YHFL EAKSLFNQET Sbjct: 37 SISPTDTCDSIDTIWFYHFLWEAKSLFNQET 67 >gb|PKC53543.1| hypothetical protein RhiirA1_479089 [Rhizophagus irregularis] Length = 92 Score = 59.7 bits (143), Expect = 4e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 45 AISPTDTCDNINTVWLYHFLREAKSLFNQET 137 +ISPTDTCD+I+T+W YHFL EAKSLFNQET Sbjct: 37 SISPTDTCDSIDTIWFYHFLWEAKSLFNQET 67 >gb|PKY48292.1| hypothetical protein RhiirA4_463850 [Rhizophagus irregularis] Length = 480 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 45 AISPTDTCDNINTVWLYHFLREAKSLFNQET 137 +ISPTDTCDN++ VWLYHFLREAKSLFNQET Sbjct: 37 SISPTDTCDNLDGVWLYHFLREAKSLFNQET 67 >gb|PKC59258.1| hypothetical protein RhiirA1_469727 [Rhizophagus irregularis] Length = 398 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 45 AISPTDTCDNINTVWLYHFLREAKSLFNQET 137 +ISPTDTCDN++TVW YHFLREAKSLFNQ+T Sbjct: 37 SISPTDTCDNLDTVWFYHFLREAKSLFNQKT 67 >gb|PKB97353.1| hypothetical protein RhiirA5_433305 [Rhizophagus irregularis] Length = 399 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 45 AISPTDTCDNINTVWLYHFLREAKSLFNQET 137 +ISPTDTCDN++TVW YHFLREAKSLFNQ+T Sbjct: 37 SISPTDTCDNLDTVWFYHFLREAKSLFNQKT 67 >gb|EXX63517.1| hypothetical protein RirG_151660 [Rhizophagus irregularis DAOM 197198w] dbj|GBC47600.1| hypothetical protein: PROVISIONAL [Rhizophagus irregularis DAOM 181602] gb|POG65672.1| hypothetical protein GLOIN_2v1781418 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 446 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 45 AISPTDTCDNINTVWLYHFLREAKSLFNQET 137 +ISPTDTCDN++TVW YHFLREAKSLFNQ+T Sbjct: 37 SISPTDTCDNLDTVWFYHFLREAKSLFNQKT 67 >gb|PKY46166.1| hypothetical protein RhiirA4_460975 [Rhizophagus irregularis] Length = 401 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 42 LAISPTDTCDNINTVWLYHFLREAKSLFNQET 137 + ISPTDTCDN+NTVW +HFLREAKSLF+QET Sbjct: 36 ILISPTDTCDNLNTVWFHHFLREAKSLFDQET 67 >gb|ORY00404.1| cyclin-like protein [Basidiobolus meristosporus CBS 931.73] Length = 331 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/79 (36%), Positives = 51/79 (64%) Frame = -3 Query: 648 KIEKFELDEIEKIIKEYEPTPLNKAKEIDARLHKCKNPEKNPNSAISRKRKLEREGLEDA 469 K++K L EIE+ +++Y+P + +EID RL C+NPEKNP S + +++K + E E+ Sbjct: 252 KLQKI-LGEIEQTLQDYKPVQIAVVREIDRRLIFCRNPEKNPESLLFKRKKAQEEEEENQ 310 Query: 468 DHHKKKRIEDEYQKSLEEV 412 KK+++ +E +K + V Sbjct: 311 RKLKKQKLVEEKEKEIASV 329 >gb|EXX67675.1| hypothetical protein RirG_112320 [Rhizophagus irregularis DAOM 197198w] dbj|GBC52915.1| JEMT01017629.1_cds_EXX67675.1_12355: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 166 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 48 ISPTDTCDNINTVWLYHFLREAKSLFNQET 137 ISPTDTCD ++T+W YHFL EAKSLFNQET Sbjct: 38 ISPTDTCDRLDTIWFYHFLWEAKSLFNQET 67 >gb|POG73100.1| hypothetical protein GLOIN_2v1772856 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 398 Score = 58.2 bits (139), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 48 ISPTDTCDNINTVWLYHFLREAKSLFNQET 137 ISPTDTCD ++T+W YHFL EAKSLFNQET Sbjct: 38 ISPTDTCDRLDTIWFYHFLWEAKSLFNQET 67