BLASTX nr result
ID: Ophiopogon26_contig00019049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019049 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250382.1| double-stranded RNA-binding protein 1-like [... 44 5e-06 >ref|XP_020250382.1| double-stranded RNA-binding protein 1-like [Asparagus officinalis] gb|ONK55143.1| uncharacterized protein A4U43_UnF7180 [Asparagus officinalis] Length = 351 Score = 43.5 bits (101), Expect(2) = 5e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = +1 Query: 76 SPCRGSLNGFFRYSSHRQIFHGKTYTGDPAKSKKEAEQLAA 198 S GS++ F S+ IF+G+TYTGDP ++KKEAEQ+AA Sbjct: 121 SQATGSIHPMFISST---IFNGQTYTGDPGRNKKEAEQMAA 158 Score = 34.3 bits (77), Expect(2) = 5e-06 Identities = 17/40 (42%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = +2 Query: 176 KRQSSWLLARAVIESILTG---RRLVCKIVRSKRKLCAAF 286 K+++ + ARA I+SIL + + +++RSK+KLCAAF Sbjct: 150 KKEAEQMAARAAIKSILANSDSQSPMLEVIRSKKKLCAAF 189