BLASTX nr result
ID: Ophiopogon26_contig00019006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00019006 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257523.1| uncharacterized protein LOC109834044 isoform... 72 6e-12 ref|XP_020257522.1| uncharacterized protein LOC109834044 isoform... 72 6e-12 ref|XP_020257521.1| uncharacterized protein LOC109834044 isoform... 72 6e-12 ref|XP_020257520.1| uncharacterized protein LOC109834044 isoform... 72 6e-12 gb|PKA57093.1| hypothetical protein AXF42_Ash002397 [Apostasia s... 67 5e-10 ref|XP_010916643.1| PREDICTED: uncharacterized protein LOC105041... 67 5e-10 ref|XP_008805249.1| PREDICTED: uncharacterized protein LOC103718... 67 5e-10 ref|XP_010916642.1| PREDICTED: uncharacterized protein LOC105041... 67 5e-10 ref|XP_020104728.1| uncharacterized protein LOC109721488 [Ananas... 67 7e-10 gb|OAY66702.1| hypothetical protein ACMD2_02147, partial [Ananas... 67 7e-10 ref|XP_017970905.1| PREDICTED: uncharacterized protein LOC186111... 67 7e-10 gb|EOX91373.1| C-terminal LisH motif isoform 1 [Theobroma cacao] 67 7e-10 ref|XP_016512946.1| PREDICTED: uncharacterized protein LOC107829... 64 7e-10 gb|KYP42157.1| hypothetical protein KK1_036442 [Cajanus cajan] 66 1e-09 ref|XP_020239723.1| uncharacterized protein LOC109818612 [Cajanu... 66 1e-09 ref|XP_007155936.1| hypothetical protein PHAVU_003G244900g [Phas... 66 1e-09 ref|XP_014509059.1| uncharacterized protein LOC106768419 [Vigna ... 66 1e-09 ref|XP_017410321.1| PREDICTED: uncharacterized protein LOC108322... 66 1e-09 ref|XP_019450011.1| PREDICTED: uncharacterized protein LOC109352... 66 1e-09 ref|XP_003525773.1| PREDICTED: uncharacterized protein LOC100794... 66 1e-09 >ref|XP_020257523.1| uncharacterized protein LOC109834044 isoform X4 [Asparagus officinalis] ref|XP_020257524.1| uncharacterized protein LOC109834044 isoform X4 [Asparagus officinalis] Length = 556 Score = 72.4 bits (176), Expect = 6e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLLMQNNGNAE VIQQIFS Sbjct: 520 GAILKVMEFLALPRADAIHLLMQNNGNAETVIQQIFS 556 >ref|XP_020257522.1| uncharacterized protein LOC109834044 isoform X3 [Asparagus officinalis] Length = 588 Score = 72.4 bits (176), Expect = 6e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLLMQNNGNAE VIQQIFS Sbjct: 552 GAILKVMEFLALPRADAIHLLMQNNGNAETVIQQIFS 588 >ref|XP_020257521.1| uncharacterized protein LOC109834044 isoform X2 [Asparagus officinalis] Length = 617 Score = 72.4 bits (176), Expect = 6e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLLMQNNGNAE VIQQIFS Sbjct: 581 GAILKVMEFLALPRADAIHLLMQNNGNAETVIQQIFS 617 >ref|XP_020257520.1| uncharacterized protein LOC109834044 isoform X1 [Asparagus officinalis] gb|ONK75687.1| uncharacterized protein A4U43_C03F19490 [Asparagus officinalis] Length = 704 Score = 72.4 bits (176), Expect = 6e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLLMQNNGNAE VIQQIFS Sbjct: 668 GAILKVMEFLALPRADAIHLLMQNNGNAETVIQQIFS 704 >gb|PKA57093.1| hypothetical protein AXF42_Ash002397 [Apostasia shenzhenica] Length = 700 Score = 67.0 bits (162), Expect = 5e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLLMQ NGNAE VIQQIFS Sbjct: 665 AILKVMEFLALPRADAIHLLMQYNGNAETVIQQIFS 700 >ref|XP_010916643.1| PREDICTED: uncharacterized protein LOC105041379 isoform X2 [Elaeis guineensis] Length = 702 Score = 67.0 bits (162), Expect = 5e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLLMQ NGNAE VIQQIFS Sbjct: 667 AILKVMEFLALPRADAIHLLMQYNGNAETVIQQIFS 702 >ref|XP_008805249.1| PREDICTED: uncharacterized protein LOC103718286 [Phoenix dactylifera] Length = 702 Score = 67.0 bits (162), Expect = 5e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLLMQ NGNAE VIQQIFS Sbjct: 667 AILKVMEFLALPRADAIHLLMQYNGNAETVIQQIFS 702 >ref|XP_010916642.1| PREDICTED: uncharacterized protein LOC105041379 isoform X1 [Elaeis guineensis] Length = 710 Score = 67.0 bits (162), Expect = 5e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLLMQ NGNAE VIQQIFS Sbjct: 675 AILKVMEFLALPRADAIHLLMQYNGNAETVIQQIFS 710 >ref|XP_020104728.1| uncharacterized protein LOC109721488 [Ananas comosus] Length = 667 Score = 66.6 bits (161), Expect = 7e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLLMQ NGNAE VIQQIFS Sbjct: 632 AILKVMEFLALPRADAIHLLMQCNGNAETVIQQIFS 667 >gb|OAY66702.1| hypothetical protein ACMD2_02147, partial [Ananas comosus] Length = 670 Score = 66.6 bits (161), Expect = 7e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLLMQ NGNAE VIQQIFS Sbjct: 635 AILKVMEFLALPRADAIHLLMQCNGNAETVIQQIFS 670 >ref|XP_017970905.1| PREDICTED: uncharacterized protein LOC18611104 [Theobroma cacao] Length = 694 Score = 66.6 bits (161), Expect = 7e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLL QNNGNAE VIQQIF+ Sbjct: 659 AILKVMEFLALPRADAIHLLAQNNGNAETVIQQIFA 694 >gb|EOX91373.1| C-terminal LisH motif isoform 1 [Theobroma cacao] Length = 782 Score = 66.6 bits (161), Expect = 7e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLL QNNGNAE VIQQIF+ Sbjct: 747 AILKVMEFLALPRADAIHLLAQNNGNAETVIQQIFA 782 >ref|XP_016512946.1| PREDICTED: uncharacterized protein LOC107829988 [Nicotiana tabacum] Length = 143 Score = 63.5 bits (153), Expect = 7e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 441 AILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 AILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 108 AILKVMEFLALPRADAIHLLAQYNGNAETVIQQIFA 143 >gb|KYP42157.1| hypothetical protein KK1_036442 [Cajanus cajan] Length = 545 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 509 GAILKVMEFLALPRADAIHLLAQYNGNAETVIQQIFA 545 >ref|XP_020239723.1| uncharacterized protein LOC109818612 [Cajanus cajan] Length = 602 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 566 GAILKVMEFLALPRADAIHLLAQYNGNAETVIQQIFA 602 >ref|XP_007155936.1| hypothetical protein PHAVU_003G244900g [Phaseolus vulgaris] gb|ESW27930.1| hypothetical protein PHAVU_003G244900g [Phaseolus vulgaris] Length = 703 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 667 GAILKVMEFLALPRADAIHLLAQYNGNAETVIQQIFA 703 >ref|XP_014509059.1| uncharacterized protein LOC106768419 [Vigna radiata var. radiata] Length = 704 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 668 GAILKVMEFLALPRADAIHLLSQYNGNAETVIQQIFA 704 >ref|XP_017410321.1| PREDICTED: uncharacterized protein LOC108322672 [Vigna angularis] gb|KOM29545.1| hypothetical protein LR48_Vigan727s000400 [Vigna angularis] dbj|BAT75573.1| hypothetical protein VIGAN_01345100 [Vigna angularis var. angularis] Length = 704 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 668 GAILKVMEFLALPRADAIHLLAQYNGNAETVIQQIFA 704 >ref|XP_019450011.1| PREDICTED: uncharacterized protein LOC109352466 isoform X1 [Lupinus angustifolius] gb|OIW07649.1| hypothetical protein TanjilG_17664 [Lupinus angustifolius] Length = 705 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 669 GAILKVMEFLALPRADAIHLLAQYNGNAETVIQQIFT 705 >ref|XP_003525773.1| PREDICTED: uncharacterized protein LOC100794305 isoform X1 [Glycine max] gb|KRH57794.1| hypothetical protein GLYMA_05G084300 [Glycine max] gb|KRH57795.1| hypothetical protein GLYMA_05G084300 [Glycine max] Length = 705 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 444 GAILKVMEFLALPRADAIHLLMQNNGNAEAVIQQIFS 334 GAILKVMEFLALPRADAIHLL Q NGNAE VIQQIF+ Sbjct: 669 GAILKVMEFLALPRADAIHLLAQYNGNAETVIQQIFA 705