BLASTX nr result
ID: Ophiopogon26_contig00018971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00018971 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273339.1| transcriptional regulator IFH1 [Asparagus of... 57 7e-07 >ref|XP_020273339.1| transcriptional regulator IFH1 [Asparagus officinalis] ref|XP_020273415.1| transcriptional regulator IFH1 [Asparagus officinalis] gb|ONK81965.1| uncharacterized protein A4U43_C01F34730 [Asparagus officinalis] Length = 191 Score = 56.6 bits (135), Expect = 7e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 MDLLLGVADLQTPEAVAAAEATIGGFQPSAA 95 MDLLLGVADL TPEAV AAEATIGGF PSAA Sbjct: 102 MDLLLGVADLHTPEAVTAAEATIGGFHPSAA 132