BLASTX nr result
ID: Ophiopogon26_contig00018932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00018932 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252920.1| LETM1 and EF-hand domain-containing protein ... 72 4e-12 ref|XP_020246100.1| LETM1 and EF-hand domain-containing protein ... 69 6e-11 ref|XP_009396159.1| PREDICTED: LETM1 and EF-hand domain-containi... 55 3e-06 >ref|XP_020252920.1| LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Asparagus officinalis] gb|ONK77286.1| uncharacterized protein A4U43_C02F4980 [Asparagus officinalis] Length = 743 Score = 72.4 bits (176), Expect = 4e-12 Identities = 38/64 (59%), Positives = 42/64 (65%), Gaps = 5/64 (7%) Frame = +1 Query: 217 MASRALVKGRKYLFGHLNVPVRPCCGLSCVAHGTFGQDSDTNVQG-----CERESVSVPK 381 MASRA+V+GRK L HLN P RPC G S AHG GQDSD VQG + ES+ VPK Sbjct: 1 MASRAIVRGRKCLLRHLNGPFRPCSGFSSFAHGRSGQDSDKKVQGFNYSDSKEESILVPK 60 Query: 382 EYLH 393 E LH Sbjct: 61 ENLH 64 >ref|XP_020246100.1| LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Asparagus officinalis] gb|ONK57880.1| uncharacterized protein A4U43_C09F5150 [Asparagus officinalis] Length = 744 Score = 68.9 bits (167), Expect = 6e-11 Identities = 35/65 (53%), Positives = 42/65 (64%), Gaps = 6/65 (9%) Frame = +1 Query: 217 MASRALVKGRKYLFGHLNVPVRPCCGLSCVAHGTFGQDSDTNVQGC------ERESVSVP 378 MASRA+V+GRKY+ GHLNV VRPC G S A G F QDSD Q E+ES + Sbjct: 1 MASRAIVRGRKYILGHLNVTVRPCSGFSSFAQGKFSQDSDRKAQDSNYSECKEQESNIIQ 60 Query: 379 KEYLH 393 +EYL+ Sbjct: 61 REYLY 65 >ref|XP_009396159.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial [Musa acuminata subsp. malaccensis] Length = 760 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 6/64 (9%) Frame = +1 Query: 217 MASRALVKGRKYLFGHLNVPVRPCCGLSCVAHGTFGQDSDTNV------QGCERESVSVP 378 MAS+A+VKGRKY+ HL++PVR C S + HG + D+DT V Q C S Sbjct: 1 MASQAIVKGRKYVLKHLSLPVRSCSSFSSLGHGRYASDTDTRVPTWISEQSCSEVESSGQ 60 Query: 379 KEYL 390 K+++ Sbjct: 61 KKHV 64