BLASTX nr result
ID: Ophiopogon26_contig00018821
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00018821 (1216 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81672.1| uncharacterized protein A4U43_C01F31700 [Asparagu... 84 1e-15 >gb|ONK81672.1| uncharacterized protein A4U43_C01F31700 [Asparagus officinalis] Length = 154 Score = 84.3 bits (207), Expect = 1e-15 Identities = 53/99 (53%), Positives = 58/99 (58%) Frame = -2 Query: 888 PCFNFRHGATXXXXXXXXXXXXXRNPTVDRAAELSLMKEGLLTSHKLRDLFICSPPHLAA 709 PCF+FR RNPTV R++ELSL KEGLLTSHKLRDLFICSPPHL A Sbjct: 39 PCFSFRCAVPLKGFLGRRFLLRDRNPTVHRSSELSL-KEGLLTSHKLRDLFICSPPHLVA 97 Query: 708 DVVSSDHSLIVKKSASTSTSTDGVNGFGSLMGRVEEYPV 592 V S+ S I K NGFGSL G EE+PV Sbjct: 98 AV--SEQSSINKFEVG--------NGFGSLTGPAEEFPV 126