BLASTX nr result
ID: Ophiopogon26_contig00018690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00018690 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI79430.1| hypothetical protein CRG98_000177 [Punica granatum] 62 3e-08 ref|XP_010024120.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 62 3e-08 ref|XP_003557256.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 61 4e-08 ref|XP_010538757.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 61 5e-08 gb|PKI66404.1| hypothetical protein CRG98_013206 [Punica granatum] 59 7e-08 gb|POF15995.1| isoform 2 of u4/u6.u5 tri-snrnp-associated protei... 57 1e-07 gb|PKA65915.1| Ubiquitin carboxyl-terminal hydrolase 24 [Apostas... 60 1e-07 gb|OAY75533.1| U4/U6.U5 tri-snRNP-associated protein 2 [Ananas c... 60 1e-07 ref|XP_004966253.1| U4/U6.U5 tri-snRNP-associated protein 2 [Set... 60 1e-07 gb|PAN22693.1| hypothetical protein PAHAL_D00366 [Panicum hallii] 60 1e-07 dbj|BAJ90605.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 1e-07 ref|XP_015611814.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 60 1e-07 gb|EAZ44685.1| hypothetical protein OsJ_29311 [Oryza sativa Japo... 60 1e-07 ref|XP_020182691.1| U4/U6.U5 tri-snRNP-associated protein 2-like... 60 1e-07 gb|EAZ09059.1| hypothetical protein OsI_31320 [Oryza sativa Indi... 60 1e-07 ref|XP_020683718.1| U4/U6.U5 tri-snRNP-associated protein 2-like... 60 1e-07 ref|XP_006660614.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 60 1e-07 gb|OEL22137.1| U4/U6.U5 tri-snRNP-associated protein 2 [Dichanth... 60 1e-07 ref|XP_020095114.1| U4/U6.U5 tri-snRNP-associated protein 2-like... 60 1e-07 ref|XP_023908286.1| U4/U6.U5 tri-snRNP-associated protein 2-like... 57 2e-07 >gb|PKI79430.1| hypothetical protein CRG98_000177 [Punica granatum] Length = 482 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 315 KEKFEMQDLHVTETLPQMVAFSEAYMQIYEQHR 413 + K+EMQDLHV+ETLPQMVA SEAYMQIYEQH+ Sbjct: 450 RSKYEMQDLHVSETLPQMVALSEAYMQIYEQHK 482 >ref|XP_010024120.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2 [Eucalyptus grandis] ref|XP_010024121.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2 [Eucalyptus grandis] gb|KCW60548.1| hypothetical protein EUGRSUZ_H03283 [Eucalyptus grandis] Length = 569 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 3/72 (4%) Frame = +3 Query: 207 PNQGEKEKGGRWYDVLKKEKNRRREDGMALLLF*S*KEK---FEMQDLHVTETLPQMVAF 377 P G+KE+ YD++ + + + +F K + +EMQDLHV+ETLPQMVA Sbjct: 498 PTPGDKERLRSKYDLIANVVHDGKPGEGSYRVFVQRKSEELWYEMQDLHVSETLPQMVAL 557 Query: 378 SEAYMQIYEQHR 413 SEAYMQIYEQH+ Sbjct: 558 SEAYMQIYEQHQ 569 >ref|XP_003557256.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Brachypodium distachyon] gb|KQK20012.1| hypothetical protein BRADI_1g51880v3 [Brachypodium distachyon] Length = 546 Score = 61.2 bits (147), Expect = 4e-08 Identities = 36/71 (50%), Positives = 43/71 (60%), Gaps = 3/71 (4%) Frame = +3 Query: 207 PNQGEKEKGGRWYDVLKKEKNRRREDGMALLLF*S*KEK---FEMQDLHVTETLPQMVAF 377 P EKEK YD++ + + +F K + +EMQDLHVTETLPQMVA Sbjct: 475 PKPKEKEKLRSKYDLIANIVHDGKPGEGCYRVFVQRKSEEAWYEMQDLHVTETLPQMVAL 534 Query: 378 SEAYMQIYEQH 410 SEAYMQIYEQH Sbjct: 535 SEAYMQIYEQH 545 >ref|XP_010538757.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2 [Tarenaya hassleriana] Length = 577 Score = 60.8 bits (146), Expect = 5e-08 Identities = 36/72 (50%), Positives = 45/72 (62%), Gaps = 3/72 (4%) Frame = +3 Query: 207 PNQGEKEKGGRWYDVLKK-EKNRRREDGMALLLF*S*KEK--FEMQDLHVTETLPQMVAF 377 P E+EK YD++ + + EDG + E+ +EMQDLHV ETLPQMVA Sbjct: 506 PTSKEREKLRSKYDLIANIVHDGKPEDGYYRVFVQRKSEELWYEMQDLHVAETLPQMVAL 565 Query: 378 SEAYMQIYEQHR 413 SEAYMQIYEQH+ Sbjct: 566 SEAYMQIYEQHQ 577 >gb|PKI66404.1| hypothetical protein CRG98_013206 [Punica granatum] Length = 195 Score = 58.9 bits (141), Expect = 7e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQHR 413 +EMQDLHV+ETLPQMVA SEAYMQIYEQH+ Sbjct: 166 YEMQDLHVSETLPQMVALSEAYMQIYEQHK 195 >gb|POF15995.1| isoform 2 of u4/u6.u5 tri-snrnp-associated protein 2 [Quercus suber] Length = 120 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQHR 413 +EMQDLHV+ETLPQMVA SE YMQIYEQH+ Sbjct: 91 YEMQDLHVSETLPQMVALSETYMQIYEQHQ 120 >gb|PKA65915.1| Ubiquitin carboxyl-terminal hydrolase 24 [Apostasia shenzhenica] Length = 547 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 518 YEMQDLHVTETLPQMVALSEAYMQIYEQH 546 >gb|OAY75533.1| U4/U6.U5 tri-snRNP-associated protein 2 [Ananas comosus] Length = 548 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 519 YEMQDLHVTETLPQMVALSEAYMQIYEQH 547 >ref|XP_004966253.1| U4/U6.U5 tri-snRNP-associated protein 2 [Setaria italica] gb|KQL11929.1| hypothetical protein SETIT_006187mg [Setaria italica] gb|KQL11930.1| hypothetical protein SETIT_006187mg [Setaria italica] Length = 548 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 519 YEMQDLHVTETLPQMVALSEAYMQIYEQH 547 >gb|PAN22693.1| hypothetical protein PAHAL_D00366 [Panicum hallii] Length = 552 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 523 YEMQDLHVTETLPQMVALSEAYMQIYEQH 551 >dbj|BAJ90605.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 553 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 524 YEMQDLHVTETLPQMVALSEAYMQIYEQH 552 >ref|XP_015611814.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2 [Oryza sativa Japonica Group] dbj|BAD36247.1| putative U4/U6.U5 tri-snRNP-associated 65 kDa protein [Oryza sativa Japonica Group] dbj|BAD36302.1| putative U4/U6.U5 tri-snRNP-associated 65 kDa protein [Oryza sativa Japonica Group] dbj|BAF25053.1| Os09g0407900 [Oryza sativa Japonica Group] dbj|BAG92235.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAT08022.1| Os09g0407900 [Oryza sativa Japonica Group] Length = 554 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 525 YEMQDLHVTETLPQMVALSEAYMQIYEQH 553 >gb|EAZ44685.1| hypothetical protein OsJ_29311 [Oryza sativa Japonica Group] Length = 554 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 525 YEMQDLHVTETLPQMVALSEAYMQIYEQH 553 >ref|XP_020182691.1| U4/U6.U5 tri-snRNP-associated protein 2-like [Aegilops tauschii subsp. tauschii] Length = 555 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 526 YEMQDLHVTETLPQMVALSEAYMQIYEQH 554 >gb|EAZ09059.1| hypothetical protein OsI_31320 [Oryza sativa Indica Group] Length = 555 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 526 YEMQDLHVTETLPQMVALSEAYMQIYEQH 554 >ref|XP_020683718.1| U4/U6.U5 tri-snRNP-associated protein 2-like [Dendrobium catenatum] ref|XP_020683719.1| U4/U6.U5 tri-snRNP-associated protein 2-like [Dendrobium catenatum] ref|XP_020683721.1| U4/U6.U5 tri-snRNP-associated protein 2-like [Dendrobium catenatum] gb|PKU76570.1| Ubiquitin carboxyl-terminal hydrolase 24 [Dendrobium catenatum] Length = 561 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 532 YEMQDLHVTETLPQMVALSEAYMQIYEQH 560 >ref|XP_006660614.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Oryza brachyantha] Length = 562 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 533 YEMQDLHVTETLPQMVALSEAYMQIYEQH 561 >gb|OEL22137.1| U4/U6.U5 tri-snRNP-associated protein 2 [Dichanthelium oligosanthes] Length = 578 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 549 YEMQDLHVTETLPQMVALSEAYMQIYEQH 577 >ref|XP_020095114.1| U4/U6.U5 tri-snRNP-associated protein 2-like [Ananas comosus] Length = 622 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQH 410 +EMQDLHVTETLPQMVA SEAYMQIYEQH Sbjct: 593 YEMQDLHVTETLPQMVALSEAYMQIYEQH 621 >ref|XP_023908286.1| U4/U6.U5 tri-snRNP-associated protein 2-like, partial [Quercus suber] Length = 145 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 324 FEMQDLHVTETLPQMVAFSEAYMQIYEQHR 413 +EMQDLHV+ETLPQMVA SE YMQIYEQH+ Sbjct: 116 YEMQDLHVSETLPQMVALSETYMQIYEQHQ 145