BLASTX nr result
ID: Ophiopogon26_contig00018521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00018521 (594 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008339312.1| PREDICTED: probable manganese-transporting A... 64 4e-09 ref|XP_008807040.1| PREDICTED: probable manganese-transporting A... 64 6e-09 ref|XP_022882189.1| probable manganese-transporting ATPase PDR2 ... 65 7e-09 ref|XP_022882180.1| probable manganese-transporting ATPase PDR2 ... 65 7e-09 ref|XP_022882171.1| probable manganese-transporting ATPase PDR2 ... 65 7e-09 gb|KJB81177.1| hypothetical protein B456_013G132500 [Gossypium r... 64 1e-08 gb|PHT41007.1| putative manganese-transporting ATPase PDR2 [Caps... 64 2e-08 ref|XP_017182582.1| PREDICTED: probable manganese-transporting A... 64 2e-08 gb|KJB81178.1| hypothetical protein B456_013G132500 [Gossypium r... 64 2e-08 ref|XP_016463760.1| PREDICTED: probable manganese-transporting A... 64 2e-08 gb|KJB81179.1| hypothetical protein B456_013G132500 [Gossypium r... 64 2e-08 gb|KJB81180.1| hypothetical protein B456_013G132500 [Gossypium r... 64 2e-08 gb|OMP11729.1| Cation-transporting P-type ATPase [Corchorus caps... 64 2e-08 gb|PNS24064.1| hypothetical protein POPTR_T012200v3 [Populus tri... 64 2e-08 ref|XP_006384373.1| hypothetical protein POPTR_0004s14450g [Popu... 64 2e-08 ref|XP_022718455.1| probable manganese-transporting ATPase PDR2 ... 64 2e-08 ref|XP_023545963.1| probable manganese-transporting ATPase PDR2 ... 64 2e-08 ref|XP_022946270.1| probable manganese-transporting ATPase PDR2 ... 64 2e-08 ref|XP_022999110.1| probable manganese-transporting ATPase PDR2 ... 64 2e-08 gb|ONI35915.1| hypothetical protein PRUPE_1G560300 [Prunus persica] 64 2e-08 >ref|XP_008339312.1| PREDICTED: probable manganese-transporting ATPase PDR2 [Malus domestica] Length = 220 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 92 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 128 >ref|XP_008807040.1| PREDICTED: probable manganese-transporting ATPase PDR2 [Phoenix dactylifera] Length = 250 Score = 64.3 bits (155), Expect = 6e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 88 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 124 >ref|XP_022882189.1| probable manganese-transporting ATPase PDR2 isoform X3 [Olea europaea var. sylvestris] ref|XP_022882197.1| probable manganese-transporting ATPase PDR2 isoform X3 [Olea europaea var. sylvestris] ref|XP_022882205.1| probable manganese-transporting ATPase PDR2 isoform X3 [Olea europaea var. sylvestris] Length = 1186 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 SG ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 415 SGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 451 >ref|XP_022882180.1| probable manganese-transporting ATPase PDR2 isoform X2 [Olea europaea var. sylvestris] Length = 1217 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 SG ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 447 SGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 483 >ref|XP_022882171.1| probable manganese-transporting ATPase PDR2 isoform X1 [Olea europaea var. sylvestris] Length = 1218 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 SG ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 447 SGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 483 >gb|KJB81177.1| hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 607 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 416 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 452 >gb|PHT41007.1| putative manganese-transporting ATPase PDR2 [Capsicum baccatum] Length = 704 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 415 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 451 >ref|XP_017182582.1| PREDICTED: probable manganese-transporting ATPase PDR2 [Malus domestica] Length = 714 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 416 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 452 >gb|KJB81178.1| hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 717 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 416 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 452 >ref|XP_016463760.1| PREDICTED: probable manganese-transporting ATPase PDR2, partial [Nicotiana tabacum] Length = 836 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 415 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 451 >gb|KJB81179.1| hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 843 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 416 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 452 >gb|KJB81180.1| hypothetical protein B456_013G132500 [Gossypium raimondii] Length = 880 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 416 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 452 >gb|OMP11729.1| Cation-transporting P-type ATPase [Corchorus capsularis] Length = 885 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 109 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 145 >gb|PNS24064.1| hypothetical protein POPTR_T012200v3 [Populus trichocarpa] Length = 902 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 132 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 168 >ref|XP_006384373.1| hypothetical protein POPTR_0004s14450g [Populus trichocarpa] gb|PNT41105.1| hypothetical protein POPTR_004G137100v3 [Populus trichocarpa] Length = 960 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 189 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 225 >ref|XP_022718455.1| probable manganese-transporting ATPase PDR2 isoform X5 [Durio zibethinus] Length = 994 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 218 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 254 >ref|XP_023545963.1| probable manganese-transporting ATPase PDR2 isoform X3 [Cucurbita pepo subsp. pepo] ref|XP_023545964.1| probable manganese-transporting ATPase PDR2 isoform X3 [Cucurbita pepo subsp. pepo] Length = 998 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 473 IIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +I + V GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 220 VIAAGYVLVKGLEDPTRSKYKLFLSCSLIITSVIPPELPM 259 >ref|XP_022946270.1| probable manganese-transporting ATPase PDR2 isoform X3 [Cucurbita moschata] Length = 998 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 473 IIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +I + V GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 220 VIAAGYVLVKGLEDPTRSKYKLFLSCSLIITSVIPPELPM 259 >ref|XP_022999110.1| probable manganese-transporting ATPase PDR2 isoform X2 [Cucurbita maxima] Length = 999 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 473 IIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +I + V GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 220 VIAAGYVLVKGLEDPTRSKYKLFLSCSLIITSVIPPELPM 259 >gb|ONI35915.1| hypothetical protein PRUPE_1G560300 [Prunus persica] Length = 1001 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 467 SGIIMKRILCV*GLEDPTRSKYKLFLSCSLIVTSVIPPELPM 592 +G ++K+ GLEDPTRSKYKLFLSCSLI+TSVIPPELPM Sbjct: 223 AGYVLKK-----GLEDPTRSKYKLFLSCSLIITSVIPPELPM 259