BLASTX nr result
ID: Ophiopogon26_contig00016985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00016985 (647 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265319.1| mannan endo-1,4-beta-mannosidase 2-like [Asp... 63 7e-08 >ref|XP_020265319.1| mannan endo-1,4-beta-mannosidase 2-like [Asparagus officinalis] gb|ONK70091.1| uncharacterized protein A4U43_C05F30140 [Asparagus officinalis] Length = 432 Score = 62.8 bits (151), Expect = 7e-08 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -3 Query: 606 NRLLYPVIGLASCIVFVYMSFEDLNLDLELGFRFSKYKMSFVGRN 472 N LLYP+IG ASC+ F+YMSF D LDL +RFS+ KMSFVGRN Sbjct: 5 NGLLYPIIGFASCVAFIYMSFGD--LDLSFDYRFSEPKMSFVGRN 47