BLASTX nr result
ID: Ophiopogon26_contig00016782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00016782 (1073 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020277050.1| nucleolar GTP-binding protein 1 [Asparagus o... 84 3e-14 gb|ONK58982.1| uncharacterized protein A4U43_C08F1750 [Asparagus... 84 3e-14 ref|XP_008788709.1| PREDICTED: nucleolar GTP-binding protein 1 i... 80 7e-13 ref|XP_008788708.1| PREDICTED: nucleolar GTP-binding protein 1 i... 80 7e-13 ref|XP_010934882.1| PREDICTED: nucleolar GTP-binding protein 1 i... 80 8e-13 gb|OAY49479.1| hypothetical protein MANES_05G059500 [Manihot esc... 80 8e-13 ref|XP_008344408.1| PREDICTED: nucleolar GTP-binding protein 1-l... 76 9e-13 ref|XP_021613671.1| nucleolar GTP-binding protein 1 isoform X4 [... 80 9e-13 ref|XP_021613670.1| nucleolar GTP-binding protein 1 isoform X3 [... 80 9e-13 ref|XP_008788707.1| PREDICTED: nucleolar GTP-binding protein 1 i... 80 1e-12 ref|XP_008788706.1| PREDICTED: nucleolar GTP-binding protein 1 i... 80 1e-12 ref|XP_002526509.1| PREDICTED: nucleolar GTP-binding protein 1 [... 80 1e-12 ref|XP_020114793.1| nucleolar GTP-binding protein 1 isoform X2 [... 80 1e-12 gb|OAY49478.1| hypothetical protein MANES_05G059500 [Manihot esc... 80 1e-12 ref|XP_021613668.1| nucleolar GTP-binding protein 1 isoform X1 [... 80 1e-12 ref|XP_020114792.1| nucleolar GTP-binding protein 1 isoform X1 [... 80 1e-12 gb|OAY63987.1| Nucleolar GTP-binding protein 1 [Ananas comosus] 78 3e-12 gb|PIN09980.1| hypothetical protein CDL12_17438 [Handroanthus im... 78 4e-12 gb|OVA02495.1| GTP binding domain [Macleaya cordata] 78 4e-12 ref|XP_017188711.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar GT... 76 4e-12 >ref|XP_020277050.1| nucleolar GTP-binding protein 1 [Asparagus officinalis] Length = 411 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNNLERLTLAVLTHLP AVLYVHDLTGECGTS DQFITYK Sbjct: 287 DDRNNLERLTLAVLTHLPTAVLYVHDLTGECGTSPADQFITYK 329 >gb|ONK58982.1| uncharacterized protein A4U43_C08F1750 [Asparagus officinalis] Length = 471 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNNLERLTLAVLTHLP AVLYVHDLTGECGTS DQFITYK Sbjct: 347 DDRNNLERLTLAVLTHLPTAVLYVHDLTGECGTSPADQFITYK 389 >ref|XP_008788709.1| PREDICTED: nucleolar GTP-binding protein 1 isoform X4 [Phoenix dactylifera] Length = 354 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNNLE+LTLAVL+HLP AVLYVHDL+GECGTS DQFITYK Sbjct: 229 DDRNNLEKLTLAVLSHLPTAVLYVHDLSGECGTSPYDQFITYK 271 >ref|XP_008788708.1| PREDICTED: nucleolar GTP-binding protein 1 isoform X3 [Phoenix dactylifera] Length = 355 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNNLE+LTLAVL+HLP AVLYVHDL+GECGTS DQFITYK Sbjct: 230 DDRNNLEKLTLAVLSHLPTAVLYVHDLSGECGTSPYDQFITYK 272 >ref|XP_010934882.1| PREDICTED: nucleolar GTP-binding protein 1 isoform X1 [Elaeis guineensis] Length = 424 Score = 80.1 bits (196), Expect = 8e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +3 Query: 939 KPDDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 + DDRNNLE+LTLAVL+HLP AVLYVHDL+GECGTS DQFITYK Sbjct: 297 RDDDRNNLEKLTLAVLSHLPTAVLYVHDLSGECGTSPYDQFITYK 341 >gb|OAY49479.1| hypothetical protein MANES_05G059500 [Manihot esculenta] Length = 383 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVLTHLP A+LYVHDLTGECGTS DQF+ YK Sbjct: 247 EDRNNLEKLTLAVLTHLPTAILYVHDLTGECGTSASDQFVIYK 289 >ref|XP_008344408.1| PREDICTED: nucleolar GTP-binding protein 1-like [Malus domestica] Length = 161 Score = 75.9 bits (185), Expect = 9e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVL+HLP A+LYVHDL+GECGTS DQF+ YK Sbjct: 25 EDRNNLEKLTLAVLSHLPTAILYVHDLSGECGTSPSDQFVIYK 67 >ref|XP_021613671.1| nucleolar GTP-binding protein 1 isoform X4 [Manihot esculenta] Length = 388 Score = 79.7 bits (195), Expect = 9e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVLTHLP A+LYVHDLTGECGTS DQF+ YK Sbjct: 247 EDRNNLEKLTLAVLTHLPTAILYVHDLTGECGTSASDQFVIYK 289 >ref|XP_021613670.1| nucleolar GTP-binding protein 1 isoform X3 [Manihot esculenta] Length = 404 Score = 79.7 bits (195), Expect = 9e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVLTHLP A+LYVHDLTGECGTS DQF+ YK Sbjct: 263 EDRNNLEKLTLAVLTHLPTAILYVHDLTGECGTSASDQFVIYK 305 >ref|XP_008788707.1| PREDICTED: nucleolar GTP-binding protein 1 isoform X2 [Phoenix dactylifera] Length = 424 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNNLE+LTLAVL+HLP AVLYVHDL+GECGTS DQFITYK Sbjct: 299 DDRNNLEKLTLAVLSHLPTAVLYVHDLSGECGTSPYDQFITYK 341 >ref|XP_008788706.1| PREDICTED: nucleolar GTP-binding protein 1 isoform X1 [Phoenix dactylifera] Length = 425 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNNLE+LTLAVL+HLP AVLYVHDL+GECGTS DQFITYK Sbjct: 300 DDRNNLEKLTLAVLSHLPTAVLYVHDLSGECGTSPYDQFITYK 342 >ref|XP_002526509.1| PREDICTED: nucleolar GTP-binding protein 1 [Ricinus communis] gb|EEF35900.1| nucleolar GTP-binding protein, putative [Ricinus communis] Length = 443 Score = 79.7 bits (195), Expect = 1e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVLTHLP A+LYVHDLTGECGTS DQF+ YK Sbjct: 311 EDRNNLEKLTLAVLTHLPTAILYVHDLTGECGTSASDQFVIYK 353 >ref|XP_020114793.1| nucleolar GTP-binding protein 1 isoform X2 [Ananas comosus] Length = 446 Score = 79.7 bits (195), Expect = 1e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNN+ERLTLAVL+HLP AVL+VHDL+GECGTS +DQF+TYK Sbjct: 313 DDRNNIERLTLAVLSHLPTAVLFVHDLSGECGTSPDDQFVTYK 355 >gb|OAY49478.1| hypothetical protein MANES_05G059500 [Manihot esculenta] Length = 447 Score = 79.7 bits (195), Expect = 1e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVLTHLP A+LYVHDLTGECGTS DQF+ YK Sbjct: 311 EDRNNLEKLTLAVLTHLPTAILYVHDLTGECGTSASDQFVIYK 353 >ref|XP_021613668.1| nucleolar GTP-binding protein 1 isoform X1 [Manihot esculenta] gb|OAY49477.1| hypothetical protein MANES_05G059500 [Manihot esculenta] Length = 452 Score = 79.7 bits (195), Expect = 1e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVLTHLP A+LYVHDLTGECGTS DQF+ YK Sbjct: 311 EDRNNLEKLTLAVLTHLPTAILYVHDLTGECGTSASDQFVIYK 353 >ref|XP_020114792.1| nucleolar GTP-binding protein 1 isoform X1 [Ananas comosus] Length = 454 Score = 79.7 bits (195), Expect = 1e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNN+ERLTLAVL+HLP AVL+VHDL+GECGTS +DQF+TYK Sbjct: 321 DDRNNIERLTLAVLSHLPTAVLFVHDLSGECGTSPDDQFVTYK 363 >gb|OAY63987.1| Nucleolar GTP-binding protein 1 [Ananas comosus] Length = 419 Score = 78.2 bits (191), Expect = 3e-12 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DDRNN+ERLTLAVL+HLP AVL+VHDL+GECG+S +DQF+TYK Sbjct: 286 DDRNNIERLTLAVLSHLPTAVLFVHDLSGECGSSPDDQFVTYK 328 >gb|PIN09980.1| hypothetical protein CDL12_17438 [Handroanthus impetiginosus] Length = 445 Score = 78.2 bits (191), Expect = 4e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVLTHLP AVLYVHDL+GECGTS DQFI YK Sbjct: 309 EDRNNLEKLTLAVLTHLPTAVLYVHDLSGECGTSPSDQFIIYK 351 >gb|OVA02495.1| GTP binding domain [Macleaya cordata] Length = 387 Score = 77.8 bits (190), Expect = 4e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +3 Query: 948 DRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 DRNNLE+LTLAVL+HLP AVLYVHDL+GECGTS DQF+TYK Sbjct: 267 DRNNLEKLTLAVLSHLPTAVLYVHDLSGECGTSPSDQFVTYK 308 >ref|XP_017188711.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar GTP-binding protein 1-like [Malus domestica] Length = 240 Score = 75.9 bits (185), Expect = 4e-12 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +3 Query: 945 DDRNNLERLTLAVLTHLPAAVLYVHDLTGECGTSLEDQFITYK 1073 +DRNNLE+LTLAVL+HLP A+LYVHDL+GECGTS DQF+ YK Sbjct: 89 EDRNNLEKLTLAVLSHLPTAILYVHDLSGECGTSPSDQFVIYK 131