BLASTX nr result
ID: Ophiopogon26_contig00015055
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00015055 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007162753.1| hypothetical protein PHAVU_001G177600g [Phas... 51 7e-06 >ref|XP_007162753.1| hypothetical protein PHAVU_001G177600g [Phaseolus vulgaris] gb|ESW34747.1| hypothetical protein PHAVU_001G177600g [Phaseolus vulgaris] Length = 50 Score = 50.8 bits (120), Expect = 7e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 360 MGFVVVISLPFIILVAILAAVCYMLGRAQRRR 265 MGFVVVISLP I+ + ILA VCYMLGRA+ RR Sbjct: 1 MGFVVVISLPLILFILILALVCYMLGRAKGRR 32