BLASTX nr result
ID: Ophiopogon26_contig00015011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00015011 (1636 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65797.1| uncharacterized protein A4U43_C06F1070 [Asparagus... 62 6e-07 >gb|ONK65797.1| uncharacterized protein A4U43_C06F1070 [Asparagus officinalis] Length = 281 Score = 62.4 bits (150), Expect = 6e-07 Identities = 31/78 (39%), Positives = 47/78 (60%) Frame = -2 Query: 942 EKYFLNPQSFSCHQSSHVRNDMFAERRHQALRSCMEGLTQAVRLQCASIPQRHVQPRIGY 763 ++Y N Q ++ HQ+ H R D E R + + S ++G Q +++ +SIPQRH QPR Y Sbjct: 56 DRYLANLQGYNRHQNVHARIDRDNEARREIVMSSVQGPVQPTQVRYSSIPQRHFQPRPRY 115 Query: 762 GLWPTQTMNGSMSRGGKI 709 + TQ+MNG + RG I Sbjct: 116 VPYHTQSMNGLVPRGQSI 133