BLASTX nr result
ID: Ophiopogon26_contig00014985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00014985 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020687807.1| ubiquitin carboxyl-terminal hydrolase 5 isof... 76 1e-12 ref|XP_020687806.1| ubiquitin carboxyl-terminal hydrolase 5 isof... 76 1e-12 ref|XP_009415930.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 73 1e-11 ref|XP_009405527.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 72 2e-11 ref|XP_010929802.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 70 9e-11 ref|XP_010929801.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 70 9e-11 ref|XP_008794941.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca... 70 9e-11 gb|PKA49629.1| Ubiquitin carboxyl-terminal hydrolase 5 [Apostasi... 70 1e-10 gb|PIA50656.1| hypothetical protein AQUCO_01200104v1 [Aquilegia ... 69 4e-10 gb|PIA50657.1| hypothetical protein AQUCO_01200104v1 [Aquilegia ... 69 4e-10 ref|XP_020575010.1| ubiquitin carboxyl-terminal hydrolase 5 isof... 68 5e-10 ref|XP_020575008.1| ubiquitin carboxyl-terminal hydrolase 5 isof... 68 6e-10 ref|XP_020111526.1| ubiquitin carboxyl-terminal hydrolase 5 isof... 67 1e-09 ref|XP_020111525.1| ubiquitin carboxyl-terminal hydrolase 5 isof... 67 1e-09 ref|XP_020252850.1| ubiquitin carboxyl-terminal hydrolase 5 [Asp... 67 1e-09 gb|OVA10566.1| Ubiquitin carboxyl-terminal hydrolases family 2 [... 67 1e-09 ref|XP_006663437.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 67 2e-09 gb|OAY68879.1| Ubiquitin carboxyl-terminal hydrolase 5 [Ananas c... 66 3e-09 dbj|BAT13998.1| Os11g0473350, partial [Oryza sativa Japonica Group] 59 9e-09 ref|XP_015897969.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 65 9e-09 >ref|XP_020687807.1| ubiquitin carboxyl-terminal hydrolase 5 isoform X2 [Dendrobium catenatum] Length = 954 Score = 75.9 bits (185), Expect = 1e-12 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSH+SP+NEE+++S+AAYVLFYRRV+ ++ SPSNG Q NQ+H+LC R Sbjct: 905 DDSHVSPINEEEVKSAAAYVLFYRRVRADNPSPSNGAQSCANQSHSLCHR 954 >ref|XP_020687806.1| ubiquitin carboxyl-terminal hydrolase 5 isoform X1 [Dendrobium catenatum] gb|PKU81052.1| Ubiquitin carboxyl-terminal hydrolase 5 [Dendrobium catenatum] Length = 957 Score = 75.9 bits (185), Expect = 1e-12 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSH+SP+NEE+++S+AAYVLFYRRV+ ++ SPSNG Q NQ+H+LC R Sbjct: 908 DDSHVSPINEEEVKSAAAYVLFYRRVRADNPSPSNGAQSCANQSHSLCHR 957 >ref|XP_009415930.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Musa acuminata subsp. malaccensis] Length = 945 Score = 72.8 bits (177), Expect = 1e-11 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NEE+++S+AAYVLFYRR K ED S S G + Y N+NH+L RR Sbjct: 896 DDSHISPINEEEVKSAAAYVLFYRRTKGEDASTSIGAESYANKNHSLSRR 945 >ref|XP_009405527.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5-like [Musa acuminata subsp. malaccensis] Length = 941 Score = 72.4 bits (176), Expect = 2e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NEED++S+AAYVLFYRR K ED S + G + Y N+NHN +R Sbjct: 892 DDSHISPINEEDVKSAAAYVLFYRRTKGEDASTNIGAEPYANKNHNFSKR 941 >ref|XP_010929802.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5 isoform X2 [Elaeis guineensis] Length = 915 Score = 70.5 bits (171), Expect = 9e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NE+D++S+AAYVLFYRR K E S SNG Q NQN+N RR Sbjct: 866 DDSHISPINEDDVKSAAAYVLFYRRAKGEGASASNGAQSCANQNYNSTRR 915 >ref|XP_010929801.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5 isoform X1 [Elaeis guineensis] Length = 947 Score = 70.5 bits (171), Expect = 9e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NE+D++S+AAYVLFYRR K E S SNG Q NQN+N RR Sbjct: 898 DDSHISPINEDDVKSAAAYVLFYRRAKGEGASASNGAQSCANQNYNSTRR 947 >ref|XP_008794941.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 5 [Phoenix dactylifera] Length = 947 Score = 70.5 bits (171), Expect = 9e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NE+D++S+AAYVLFYRR K E S SNG Q NQN+N RR Sbjct: 898 DDSHISPINEDDVKSAAAYVLFYRRAKGEGASASNGAQSCANQNYNSSRR 947 >gb|PKA49629.1| Ubiquitin carboxyl-terminal hydrolase 5 [Apostasia shenzhenica] Length = 944 Score = 70.1 bits (170), Expect = 1e-10 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DD+H+S +NEED++S+AAYVLFYRRV+ E+ SPSNG Q Q+ +LCRR Sbjct: 895 DDTHVSLINEEDVKSAAAYVLFYRRVRTENASPSNGAQSSAYQSQSLCRR 944 >gb|PIA50656.1| hypothetical protein AQUCO_01200104v1 [Aquilegia coerulea] Length = 883 Score = 68.6 bits (166), Expect = 4e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DD+H+S +NEED++S+AAYVLFYRRVK ED S SNG Q V QNH L + Sbjct: 833 DDNHVSTINEEDVKSAAAYVLFYRRVKTEDVSVSNGAQSSVGQNHMLLEK 882 >gb|PIA50657.1| hypothetical protein AQUCO_01200104v1 [Aquilegia coerulea] Length = 935 Score = 68.6 bits (166), Expect = 4e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DD+H+S +NEED++S+AAYVLFYRRVK ED S SNG Q V QNH L + Sbjct: 885 DDNHVSTINEEDVKSAAAYVLFYRRVKTEDVSVSNGAQSSVGQNHMLLEK 934 >ref|XP_020575010.1| ubiquitin carboxyl-terminal hydrolase 5 isoform X2 [Phalaenopsis equestris] Length = 808 Score = 68.2 bits (165), Expect = 5e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSH+S +NEE+++S+AAYVLFYRRV+ ++ S SNG Q NQ+H+ C R Sbjct: 759 DDSHVSSINEEEVKSAAAYVLFYRRVRTDNPSTSNGAQSCANQSHSFCHR 808 >ref|XP_020575008.1| ubiquitin carboxyl-terminal hydrolase 5 isoform X1 [Phalaenopsis equestris] ref|XP_020575009.1| ubiquitin carboxyl-terminal hydrolase 5 isoform X1 [Phalaenopsis equestris] Length = 948 Score = 68.2 bits (165), Expect = 6e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSH+S +NEE+++S+AAYVLFYRRV+ ++ S SNG Q NQ+H+ C R Sbjct: 899 DDSHVSSINEEEVKSAAAYVLFYRRVRTDNPSTSNGAQSCANQSHSFCHR 948 >ref|XP_020111526.1| ubiquitin carboxyl-terminal hydrolase 5 isoform X2 [Ananas comosus] Length = 934 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NE++++S+AAYVLFYRR+KVED + SNG N H+ RR Sbjct: 885 DDSHISPINEDEVKSAAAYVLFYRRIKVEDAAISNGALSCANPTHSFSRR 934 >ref|XP_020111525.1| ubiquitin carboxyl-terminal hydrolase 5 isoform X1 [Ananas comosus] Length = 942 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NE++++S+AAYVLFYRR+KVED + SNG N H+ RR Sbjct: 893 DDSHISPINEDEVKSAAAYVLFYRRIKVEDAAISNGALSCANPTHSFSRR 942 >ref|XP_020252850.1| ubiquitin carboxyl-terminal hydrolase 5 [Asparagus officinalis] gb|ONK77221.1| uncharacterized protein A4U43_C02F4330 [Asparagus officinalis] Length = 941 Score = 67.0 bits (162), Expect = 1e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DD H+SP+NE+++RSSAAYVLFYRRVK +D SPS G Q+Y N NL RR Sbjct: 893 DDGHVSPINEDEVRSSAAYVLFYRRVKGKDESPS-GRQLYANPKPNLYRR 941 >gb|OVA10566.1| Ubiquitin carboxyl-terminal hydrolases family 2 [Macleaya cordata] Length = 966 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNH 420 DDSHISP+NEED++S+AAYVLFYRRVK ED S SNG Q QN+ Sbjct: 917 DDSHISPINEEDVKSAAAYVLFYRRVKSEDVSVSNGAQSCAGQNN 961 >ref|XP_006663437.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5, partial [Oryza brachyantha] Length = 908 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSH+S +NEED++S AAYVLFYRRV+ DG+ SNG Q Y NQNH +R Sbjct: 861 DDSHVSAINEEDVKSGAAYVLFYRRVR--DGTASNGIQSYANQNHRSSQR 908 >gb|OAY68879.1| Ubiquitin carboxyl-terminal hydrolase 5 [Ananas comosus] Length = 930 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSHISP+NE++++S AAYVLFYRR+KVED + SNG N H+ RR Sbjct: 881 DDSHISPINEDEVKSVAAYVLFYRRIKVEDAAISNGALSCANPTHSFSRR 930 >dbj|BAT13998.1| Os11g0473350, partial [Oryza sativa Japonica Group] Length = 55 Score = 59.3 bits (142), Expect = 9e-09 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQVYVNQNHNLCRR 405 DDSH+S +NEED++S AAYVLFYRRV+ G+ SN +VNQNH +R Sbjct: 8 DDSHVSAINEEDVKSGAAYVLFYRRVR--GGAASNAIHPHVNQNHRSSQR 55 >ref|XP_015897969.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 5 isoform X2 [Ziziphus jujuba] Length = 910 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 554 DDSHISPMNEEDMRSSAAYVLFYRRVKVEDGSPSNGGQ 441 DDSHISP+NEED++SSAAYVLFYRRVK ED + SNG Q Sbjct: 865 DDSHISPINEEDVKSSAAYVLFYRRVKTEDANVSNGVQ 902