BLASTX nr result
ID: Ophiopogon26_contig00014863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00014863 (1269 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014752843.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like... 60 7e-06 >ref|XP_014752843.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Brachypodium distachyon] gb|KQK13492.1| hypothetical protein BRADI_1g10490v3 [Brachypodium distachyon] Length = 589 Score = 59.7 bits (143), Expect = 7e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 98 RCLDKAATISAHDVKTESFSNPWQLCTVTQVE 3 RCLDKAATIS DVKT+SF+NPW++CTVTQVE Sbjct: 316 RCLDKAATISDFDVKTDSFTNPWRVCTVTQVE 347