BLASTX nr result
ID: Ophiopogon26_contig00014817
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00014817 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020578531.1| ubiquitin receptor RAD23b-like isoform X2 [P... 67 8e-10 gb|PKA49416.1| Putative DNA repair protein RAD23-1 [Apostasia sh... 67 8e-10 ref|XP_020578528.1| ubiquitin receptor RAD23b-like isoform X1 [P... 67 8e-10 ref|XP_020269801.1| LOW QUALITY PROTEIN: ubiquitin receptor RAD2... 66 2e-09 ref|XP_020407145.1| uncharacterized protein LOC100282427 isoform... 65 2e-09 gb|AQK60238.1| Ubiquitin receptor RAD23b [Zea mays] 65 3e-09 gb|AQK60241.1| Ubiquitin receptor RAD23b [Zea mays] 65 3e-09 ref|NP_001148810.1| uncharacterized protein LOC100282427 [Zea ma... 65 3e-09 ref|XP_008677244.1| uncharacterized protein LOC100282427 isoform... 65 3e-09 gb|PKU72033.1| Putative DNA repair protein RAD23-1 [Dendrobium c... 65 3e-09 ref|XP_020687287.1| ubiquitin receptor RAD23b-like [Dendrobium c... 65 3e-09 ref|XP_018681177.1| PREDICTED: ubiquitin receptor RAD23b-like is... 65 4e-09 ref|XP_009418030.1| PREDICTED: ubiquitin receptor RAD23b-like is... 65 4e-09 gb|OQU84490.1| hypothetical protein SORBI_3004G064600 [Sorghum b... 65 5e-09 ref|XP_002451657.1| ubiquitin receptor RAD23b isoform X2 [Sorghu... 65 5e-09 ref|XP_021315964.1| ubiquitin receptor RAD23b isoform X1 [Sorghu... 65 5e-09 ref|XP_009398645.1| PREDICTED: ubiquitin receptor RAD23b [Musa a... 65 5e-09 ref|XP_020103404.1| ubiquitin receptor RAD23b-like isoform X2 [A... 64 9e-09 ref|XP_020103402.1| ubiquitin receptor RAD23b-like isoform X1 [A... 64 9e-09 gb|OAY64428.1| Ubiquitin receptor RAD23b [Ananas comosus] 64 9e-09 >ref|XP_020578531.1| ubiquitin receptor RAD23b-like isoform X2 [Phalaenopsis equestris] Length = 379 Score = 67.0 bits (162), Expect = 8e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH GDED Sbjct: 348 FDRARVIEAFLACDRNEELAANYLLEHAGDED 379 >gb|PKA49416.1| Putative DNA repair protein RAD23-1 [Apostasia shenzhenica] Length = 387 Score = 67.0 bits (162), Expect = 8e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH GDED Sbjct: 356 FDRARVIEAFLACDRNEELAANYLLEHAGDED 387 >ref|XP_020578528.1| ubiquitin receptor RAD23b-like isoform X1 [Phalaenopsis equestris] ref|XP_020578530.1| ubiquitin receptor RAD23b-like isoform X1 [Phalaenopsis equestris] Length = 389 Score = 67.0 bits (162), Expect = 8e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH GDED Sbjct: 358 FDRARVIEAFLACDRNEELAANYLLEHAGDED 389 >ref|XP_020269801.1| LOW QUALITY PROTEIN: ubiquitin receptor RAD23b-like [Asparagus officinalis] Length = 367 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVI AFLACDRNEELAANYLLEHVGDED Sbjct: 336 FDRARVIVAFLACDRNEELAANYLLEHVGDED 367 >ref|XP_020407145.1| uncharacterized protein LOC100282427 isoform X3 [Zea mays] Length = 315 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH G+ED Sbjct: 284 FDRARVIEAFLACDRNEELAANYLLEHAGEED 315 >gb|AQK60238.1| Ubiquitin receptor RAD23b [Zea mays] Length = 345 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH G+ED Sbjct: 314 FDRARVIEAFLACDRNEELAANYLLEHAGEED 345 >gb|AQK60241.1| Ubiquitin receptor RAD23b [Zea mays] Length = 359 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH G+ED Sbjct: 328 FDRARVIEAFLACDRNEELAANYLLEHAGEED 359 >ref|NP_001148810.1| uncharacterized protein LOC100282427 [Zea mays] ref|XP_008677246.1| uncharacterized protein LOC100282427 isoform X2 [Zea mays] gb|ACG32973.1| DNA repair protein RAD23-1 [Zea mays] gb|ACR38049.1| unknown [Zea mays] gb|AQK60239.1| Ubiquitin receptor RAD23b [Zea mays] gb|AQK60240.1| Ubiquitin receptor RAD23b [Zea mays] Length = 368 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH G+ED Sbjct: 337 FDRARVIEAFLACDRNEELAANYLLEHAGEED 368 >ref|XP_008677244.1| uncharacterized protein LOC100282427 isoform X1 [Zea mays] ref|XP_008677245.1| uncharacterized protein LOC100282427 isoform X1 [Zea mays] Length = 369 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH G+ED Sbjct: 338 FDRARVIEAFLACDRNEELAANYLLEHAGEED 369 >gb|PKU72033.1| Putative DNA repair protein RAD23-1 [Dendrobium catenatum] Length = 393 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH G+ED Sbjct: 362 FDRARVIEAFLACDRNEELAANYLLEHTGEED 393 >ref|XP_020687287.1| ubiquitin receptor RAD23b-like [Dendrobium catenatum] Length = 397 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACDRNEELAANYLLEH G+ED Sbjct: 366 FDRARVIEAFLACDRNEELAANYLLEHTGEED 397 >ref|XP_018681177.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 372 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARV+EAFLACDRNE+LAANYLLEH GDED Sbjct: 341 FDRARVLEAFLACDRNEQLAANYLLEHAGDED 372 >ref|XP_009418030.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_009418037.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_009418045.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 384 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARV+EAFLACDRNE+LAANYLLEH GDED Sbjct: 353 FDRARVLEAFLACDRNEQLAANYLLEHAGDED 384 >gb|OQU84490.1| hypothetical protein SORBI_3004G064600 [Sorghum bicolor] Length = 357 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAF+ACDRNEELAANYLLEH G+ED Sbjct: 326 FDRARVIEAFIACDRNEELAANYLLEHAGEED 357 >ref|XP_002451657.1| ubiquitin receptor RAD23b isoform X2 [Sorghum bicolor] gb|EES04633.1| hypothetical protein SORBI_3004G064600 [Sorghum bicolor] Length = 369 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAF+ACDRNEELAANYLLEH G+ED Sbjct: 338 FDRARVIEAFIACDRNEELAANYLLEHAGEED 369 >ref|XP_021315964.1| ubiquitin receptor RAD23b isoform X1 [Sorghum bicolor] Length = 370 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAF+ACDRNEELAANYLLEH G+ED Sbjct: 339 FDRARVIEAFIACDRNEELAANYLLEHAGEED 370 >ref|XP_009398645.1| PREDICTED: ubiquitin receptor RAD23b [Musa acuminata subsp. malaccensis] Length = 389 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDRARVIEAFLACD+NE+LAANYLLEH GDED Sbjct: 358 FDRARVIEAFLACDKNEQLAANYLLEHAGDED 389 >ref|XP_020103404.1| ubiquitin receptor RAD23b-like isoform X2 [Ananas comosus] Length = 359 Score = 63.9 bits (154), Expect = 9e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDR RVIEAFLACDRNE+LAANYLLEH GDED Sbjct: 328 FDRERVIEAFLACDRNEQLAANYLLEHAGDED 359 >ref|XP_020103402.1| ubiquitin receptor RAD23b-like isoform X1 [Ananas comosus] ref|XP_020103403.1| ubiquitin receptor RAD23b-like isoform X1 [Ananas comosus] Length = 374 Score = 63.9 bits (154), Expect = 9e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDR RVIEAFLACDRNE+LAANYLLEH GDED Sbjct: 343 FDRERVIEAFLACDRNEQLAANYLLEHAGDED 374 >gb|OAY64428.1| Ubiquitin receptor RAD23b [Ananas comosus] Length = 374 Score = 63.9 bits (154), Expect = 9e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FDRARVIEAFLACDRNEELAANYLLEHVGDED 98 FDR RVIEAFLACDRNE+LAANYLLEH GDED Sbjct: 343 FDRERVIEAFLACDRNEQLAANYLLEHAGDED 374