BLASTX nr result
ID: Ophiopogon26_contig00014339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00014339 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020698125.1| uncharacterized protein LOC110110830 [Dendro... 54 5e-06 >ref|XP_020698125.1| uncharacterized protein LOC110110830 [Dendrobium catenatum] Length = 164 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = +1 Query: 1 SHQLHLKCTQLVNIAKSCLQPRDKYLESTIILFDNHFSNL 120 +H+LHLKC++L+ IA SCL +D YL +++ FD HF NL Sbjct: 125 NHELHLKCSKLIEIATSCLHSKDNYLTTSVKFFDKHFQNL 164