BLASTX nr result
ID: Ophiopogon26_contig00014311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00014311 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262337.1| calcium uniporter protein 2, mitochondrial-l... 54 6e-06 gb|ONK71360.1| uncharacterized protein A4U43_C04F7700 [Asparagus... 54 6e-06 >ref|XP_020262337.1| calcium uniporter protein 2, mitochondrial-like, partial [Asparagus officinalis] Length = 300 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 241 LFLLVSQVAKAVESIIPLSIPQKNPLSVPQQNDCR 345 +FL QVAKAVESIIPLSIPQ+ L +PQQNDCR Sbjct: 125 VFLRPDQVAKAVESIIPLSIPQQKHLPIPQQNDCR 159 >gb|ONK71360.1| uncharacterized protein A4U43_C04F7700 [Asparagus officinalis] Length = 333 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 241 LFLLVSQVAKAVESIIPLSIPQKNPLSVPQQNDCR 345 +FL QVAKAVESIIPLSIPQ+ L +PQQNDCR Sbjct: 158 VFLRPDQVAKAVESIIPLSIPQQKHLPIPQQNDCR 192