BLASTX nr result
ID: Ophiopogon26_contig00014292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00014292 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243950.1| guanylate kinase 1-like [Asparagus officinalis] 54 5e-06 gb|PON49279.1| Guanylate kinase [Parasponia andersonii] 54 5e-06 gb|ONK59731.1| uncharacterized protein A4U43_C08F9820 [Asparagus... 54 6e-06 gb|PON91714.1| Guanylate kinase [Trema orientalis] 54 7e-06 >ref|XP_020243950.1| guanylate kinase 1-like [Asparagus officinalis] Length = 400 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 357 FVLDVSSLNGGAPGRTRGLNISAASSLTDSVNGIGHL 247 F LDVSSL GGAPGRTRGL ISA +S TD++NGI L Sbjct: 364 FFLDVSSLKGGAPGRTRGLIISAINSSTDNINGIEQL 400 >gb|PON49279.1| Guanylate kinase [Parasponia andersonii] Length = 403 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -2 Query: 357 FVLDVSSLNGGAPGRTRGLNISAASSLTDSVNGIGHL 247 FVLDVSSL GGAPGRTRGLNI A S D +NGI L Sbjct: 366 FVLDVSSLKGGAPGRTRGLNIYATSPFLDGLNGIHEL 402 >gb|ONK59731.1| uncharacterized protein A4U43_C08F9820 [Asparagus officinalis] Length = 458 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 357 FVLDVSSLNGGAPGRTRGLNISAASSLTDSVNGIGHL 247 F LDVSSL GGAPGRTRGL ISA +S TD++NGI L Sbjct: 422 FFLDVSSLKGGAPGRTRGLIISAINSSTDNINGIEQL 458 >gb|PON91714.1| Guanylate kinase [Trema orientalis] Length = 403 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -2 Query: 357 FVLDVSSLNGGAPGRTRGLNISAASSLTDSVNGIGHL 247 FVLDVSSL GGAPGRTRGLNI A S D +NGI L Sbjct: 366 FVLDVSSLKGGAPGRTRGLNIYAMSPFLDGLNGIHEL 402