BLASTX nr result
ID: Ophiopogon26_contig00014053
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00014053 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268370.1| uncharacterized protein LOC109843817 [Aspara... 75 3e-13 >ref|XP_020268370.1| uncharacterized protein LOC109843817 [Asparagus officinalis] ref|XP_020268371.1| uncharacterized protein LOC109843817 [Asparagus officinalis] Length = 294 Score = 74.7 bits (182), Expect = 3e-13 Identities = 49/119 (41%), Positives = 67/119 (56%), Gaps = 13/119 (10%) Frame = +3 Query: 99 VVEIDKSLTSGFENDSKEASPEIHSGETS---------PSYANMAVVHEVDRGSTSGKEV 251 +VEI+K L SGF+NDSK+ PEIH + S S A M HE+ R STS E+ Sbjct: 165 LVEINKDLFSGFKNDSKKERPEIHRNKPSGFKIDAIATSSNARMKS-HEMQRDSTSDMEL 223 Query: 252 GTTDGSVPRDST----KRMEIDKDLSSGFKNNSEKANSEIHNEEPAPSDAVTQLKNGKA 416 + D R + +EIDKDLSSGFK++++K +S+IH E S ++K KA Sbjct: 224 SSDDNMEIRSDASVFNELVEIDKDLSSGFKDDTKKESSDIHKGEAITSPPKLKIKKRKA 282