BLASTX nr result
ID: Ophiopogon26_contig00013373
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00013373 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30304.3| unnamed protein product, partial [Vitis vinifera] 55 4e-06 >emb|CBI30304.3| unnamed protein product, partial [Vitis vinifera] Length = 461 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/41 (68%), Positives = 28/41 (68%) Frame = +1 Query: 241 FLLCNSCWPFYFFPPSCIRMLPLANASGCCASFTVALQASF 363 FLLCNS WPF FPP I L ANASG ASFTV LQA F Sbjct: 8 FLLCNSFWPFILFPPFPICSLSSANASGFFASFTVVLQAYF 48