BLASTX nr result
ID: Ophiopogon26_contig00013036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00013036 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64763.1| uncharacterized protein A4U43_C07F29660 [Asparagu... 53 2e-06 >gb|ONK64763.1| uncharacterized protein A4U43_C07F29660 [Asparagus officinalis] Length = 93 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 243 REKVFRNQVFTDENLMLACRYIYLGLFDNEIEAAR 139 + + F FTDENLMLACRYIYL LFDN+IEAAR Sbjct: 6 KRESFGKPKFTDENLMLACRYIYLVLFDNKIEAAR 40