BLASTX nr result
ID: Ophiopogon26_contig00012967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00012967 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010524992.1| PREDICTED: nucleolar MIF4G domain-containing... 71 4e-16 ref|XP_020877777.1| nucleolar MIF4G domain-containing protein 1 ... 70 6e-16 gb|PIN07012.1| Protein involved in high osmolarity signaling pat... 67 7e-16 gb|PIN03404.1| Protein involved in high osmolarity signaling pat... 67 7e-16 gb|EOA19996.1| hypothetical protein CARUB_v10000263mg, partial [... 69 2e-15 ref|NP_197295.2| MIF4G domain-containing protein / MA3 domain-co... 69 2e-15 gb|OAO96234.1| hypothetical protein AXX17_AT5G17650 [Arabidopsis... 69 2e-15 ref|XP_006287098.2| nucleolar MIF4G domain-containing protein 1 ... 69 2e-15 dbj|BAB08393.1| unnamed protein product [Arabidopsis thaliana] 69 2e-15 gb|ONK70236.1| uncharacterized protein A4U43_C05F31660 [Asparagu... 69 2e-15 ref|XP_020265487.1| nucleolar MIF4G domain-containing protein 1 ... 69 2e-15 ref|XP_020576137.1| nucleolar MIF4G domain-containing protein 1 ... 67 3e-15 ref|XP_020576138.1| nucleolar MIF4G domain-containing protein 1 ... 67 3e-15 ref|XP_021897303.1| nucleolar MIF4G domain-containing protein 1-... 67 4e-15 ref|XP_018829572.1| PREDICTED: nucleolar MIF4G domain-containing... 69 4e-15 ref|XP_006400338.1| nucleolar MIF4G domain-containing protein 1 ... 67 4e-15 gb|OIT21859.1| hypothetical protein A4A49_35837 [Nicotiana atten... 64 6e-15 ref|XP_019238256.1| PREDICTED: nucleolar MIF4G domain-containing... 64 6e-15 ref|XP_009773020.1| PREDICTED: nucleolar MIF4G domain-containing... 64 6e-15 ref|XP_016497732.1| PREDICTED: nucleolar MIF4G domain-containing... 64 6e-15 >ref|XP_010524992.1| PREDICTED: nucleolar MIF4G domain-containing protein 1 [Tarenaya hassleriana] Length = 775 Score = 70.9 bits (172), Expect(3) = 4e-16 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNKYYTVLASKLC HDKNHKFTLQ + W + S S R +H Sbjct: 616 CCLQEKAFNKYYTVLASKLCEHDKNHKFTLQYCI-WDHFKEVESMSLQRSMH 666 Score = 36.6 bits (83), Expect(3) = 4e-16 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 588 DYIDAFEKLLRLDLPGKQ 605 Score = 24.3 bits (51), Expect(3) = 4e-16 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 601 LPGKQDREIMRVLV 614 >ref|XP_020877777.1| nucleolar MIF4G domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata] gb|EFH50121.1| RNA binding protein [Arabidopsis lyrata subsp. lyrata] Length = 776 Score = 70.5 bits (171), Expect(3) = 6e-16 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNKYYTVLASKLC HDKNHKFTLQ + W + S S R +H Sbjct: 619 CCLQEKAFNKYYTVLASKLCEHDKNHKFTLQYCI-WDHYKELESMSLQRSMH 669 Score = 36.6 bits (83), Expect(3) = 6e-16 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 591 DYIDAFEKLLRLDLPGKQ 608 Score = 24.3 bits (51), Expect(3) = 6e-16 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 604 LPGKQDREIMRVLV 617 >gb|PIN07012.1| Protein involved in high osmolarity signaling pathway [Handroanthus impetiginosus] Length = 957 Score = 67.0 bits (162), Expect(3) = 7e-16 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -2 Query: 315 LWGCCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 L GCC+ EK FNKYY VLASKLCS+DKNHKFTLQ + W + S S R +H Sbjct: 797 LVGCCLQEKVFNKYYCVLASKLCSYDKNHKFTLQYCL-WDHFKELESMSLIRSMH 850 Score = 37.4 bits (85), Expect(3) = 7e-16 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEKILRLDL GKQ Sbjct: 772 DYIDAFEKILRLDLPGKQ 789 Score = 26.6 bits (57), Expect(3) = 7e-16 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 352 LGNRQDREIMRVLVG 308 L +QDREIMRVLVG Sbjct: 785 LPGKQDREIMRVLVG 799 >gb|PIN03404.1| Protein involved in high osmolarity signaling pathway [Handroanthus impetiginosus] Length = 887 Score = 67.0 bits (162), Expect(3) = 7e-16 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -2 Query: 315 LWGCCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 L GCC+ EK FNKYY VLASKLCS+DKNHKFTLQ + W + S S R +H Sbjct: 727 LVGCCLQEKVFNKYYCVLASKLCSYDKNHKFTLQYCL-WDHFKELESMSLIRSMH 780 Score = 37.4 bits (85), Expect(3) = 7e-16 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEKILRLDL GKQ Sbjct: 702 DYIDAFEKILRLDLPGKQ 719 Score = 26.6 bits (57), Expect(3) = 7e-16 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 352 LGNRQDREIMRVLVG 308 L +QDREIMRVLVG Sbjct: 715 LPGKQDREIMRVLVG 729 >gb|EOA19996.1| hypothetical protein CARUB_v10000263mg, partial [Capsella rubella] Length = 786 Score = 68.9 bits (167), Expect(3) = 2e-15 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EK FNKYYTVLASKLC HDKNHKFTLQ + W + S S R +H Sbjct: 629 CCLQEKVFNKYYTVLASKLCEHDKNHKFTLQYCI-WDHFKELESMSLQRSMH 679 Score = 36.6 bits (83), Expect(3) = 2e-15 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 601 DYIDAFEKLLRLDLPGKQ 618 Score = 24.3 bits (51), Expect(3) = 2e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 614 LPGKQDREIMRVLV 627 >ref|NP_197295.2| MIF4G domain-containing protein / MA3 domain-containing protein [Arabidopsis thaliana] dbj|BAD44002.1| unknown protein [Arabidopsis thaliana] dbj|BAE98902.1| hypothetical protein [Arabidopsis thaliana] gb|AED92488.1| MIF4G domain-containing protein / MA3 domain-containing protein [Arabidopsis thaliana] Length = 784 Score = 68.9 bits (167), Expect(3) = 2e-15 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNK+YTVLASKLC HDKNHKFTLQ + W + S S R +H Sbjct: 627 CCLQEKAFNKFYTVLASKLCEHDKNHKFTLQYCI-WDHFKELESMSLQRSMH 677 Score = 36.6 bits (83), Expect(3) = 2e-15 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 599 DYIDAFEKLLRLDLPGKQ 616 Score = 24.3 bits (51), Expect(3) = 2e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 612 LPGKQDREIMRVLV 625 >gb|OAO96234.1| hypothetical protein AXX17_AT5G17650 [Arabidopsis thaliana] Length = 784 Score = 68.9 bits (167), Expect(3) = 2e-15 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNK+YTVLASKLC HDKNHKFTLQ + W + S S R +H Sbjct: 627 CCLQEKAFNKFYTVLASKLCEHDKNHKFTLQYCI-WDHFKELESMSLQRSMH 677 Score = 36.6 bits (83), Expect(3) = 2e-15 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 599 DYIDAFEKLLRLDLPGKQ 616 Score = 24.3 bits (51), Expect(3) = 2e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 612 LPGKQDREIMRVLV 625 >ref|XP_006287098.2| nucleolar MIF4G domain-containing protein 1 [Capsella rubella] Length = 780 Score = 68.9 bits (167), Expect(3) = 2e-15 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EK FNKYYTVLASKLC HDKNHKFTLQ + W + S S R +H Sbjct: 623 CCLQEKVFNKYYTVLASKLCEHDKNHKFTLQYCI-WDHFKELESMSLQRSMH 673 Score = 36.6 bits (83), Expect(3) = 2e-15 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 595 DYIDAFEKLLRLDLPGKQ 612 Score = 24.3 bits (51), Expect(3) = 2e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 608 LPGKQDREIMRVLV 621 >dbj|BAB08393.1| unnamed protein product [Arabidopsis thaliana] Length = 707 Score = 68.9 bits (167), Expect(3) = 2e-15 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNK+YTVLASKLC HDKNHKFTLQ + W + S S R +H Sbjct: 550 CCLQEKAFNKFYTVLASKLCEHDKNHKFTLQYCI-WDHFKELESMSLQRSMH 600 Score = 36.6 bits (83), Expect(3) = 2e-15 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 522 DYIDAFEKLLRLDLPGKQ 539 Score = 24.3 bits (51), Expect(3) = 2e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 535 LPGKQDREIMRVLV 548 >gb|ONK70236.1| uncharacterized protein A4U43_C05F31660 [Asparagus officinalis] Length = 804 Score = 68.6 bits (166), Expect(3) = 2e-15 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 315 LWGCCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIV 205 L GCC+ EK FNKYYTVLASKLCSHDKNHKFTLQ + Sbjct: 641 LVGCCLQEKVFNKYYTVLASKLCSHDKNHKFTLQYCI 677 Score = 34.3 bits (77), Expect(3) = 2e-15 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEKIL+L L+GKQ Sbjct: 616 DYIDAFEKILKLGLTGKQ 633 Score = 26.6 bits (57), Expect(3) = 2e-15 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 352 LGNRQDREIMRVLVG 308 L +QDREIMRVLVG Sbjct: 629 LTGKQDREIMRVLVG 643 >ref|XP_020265487.1| nucleolar MIF4G domain-containing protein 1 [Asparagus officinalis] ref|XP_020265488.1| nucleolar MIF4G domain-containing protein 1 [Asparagus officinalis] ref|XP_020265489.1| nucleolar MIF4G domain-containing protein 1 [Asparagus officinalis] ref|XP_020265490.1| nucleolar MIF4G domain-containing protein 1 [Asparagus officinalis] ref|XP_020265491.1| nucleolar MIF4G domain-containing protein 1 [Asparagus officinalis] Length = 730 Score = 68.6 bits (166), Expect(3) = 2e-15 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 315 LWGCCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIV 205 L GCC+ EK FNKYYTVLASKLCSHDKNHKFTLQ + Sbjct: 567 LVGCCLQEKVFNKYYTVLASKLCSHDKNHKFTLQYCI 603 Score = 34.3 bits (77), Expect(3) = 2e-15 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEKIL+L L+GKQ Sbjct: 542 DYIDAFEKILKLGLTGKQ 559 Score = 26.6 bits (57), Expect(3) = 2e-15 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 352 LGNRQDREIMRVLVG 308 L +QDREIMRVLVG Sbjct: 555 LTGKQDREIMRVLVG 569 >ref|XP_020576137.1| nucleolar MIF4G domain-containing protein 1 isoform X1 [Phalaenopsis equestris] Length = 765 Score = 66.6 bits (161), Expect(3) = 3e-15 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -2 Query: 315 LWGCCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLHAFLLL 136 L CC+ EK FNKYYTVLASK CSHDKNHKFTLQ + W + I S R+++ + Sbjct: 603 LLDCCLQEKVFNKYYTVLASKFCSHDKNHKFTLQYCI-WDNLKEIDSMEMIRLMNLARFI 661 Query: 135 S 133 S Sbjct: 662 S 662 Score = 38.5 bits (88), Expect(3) = 3e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DY+DAFEKILRLDLSGKQ Sbjct: 578 DYLDAFEKILRLDLSGKQ 595 Score = 23.9 bits (50), Expect(3) = 3e-15 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVL+ Sbjct: 591 LSGKQDREIMRVLL 604 >ref|XP_020576138.1| nucleolar MIF4G domain-containing protein 1 isoform X2 [Phalaenopsis equestris] Length = 759 Score = 66.6 bits (161), Expect(3) = 3e-15 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -2 Query: 315 LWGCCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLHAFLLL 136 L CC+ EK FNKYYTVLASK CSHDKNHKFTLQ + W + I S R+++ + Sbjct: 597 LLDCCLQEKVFNKYYTVLASKFCSHDKNHKFTLQYCI-WDNLKEIDSMEMIRLMNLARFI 655 Query: 135 S 133 S Sbjct: 656 S 656 Score = 38.5 bits (88), Expect(3) = 3e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DY+DAFEKILRLDLSGKQ Sbjct: 572 DYLDAFEKILRLDLSGKQ 589 Score = 23.9 bits (50), Expect(3) = 3e-15 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVL+ Sbjct: 585 LSGKQDREIMRVLL 598 >ref|XP_021897303.1| nucleolar MIF4G domain-containing protein 1-like isoform X1 [Carica papaya] Length = 340 Score = 66.6 bits (161), Expect(3) = 4e-15 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLHAFLLLSTS 127 CC+ EK FNKYY VLASKLC HDKNHKFTLQ W + S S R +H L++ Sbjct: 183 CCLQEKVFNKYYVVLASKLCQHDKNHKFTLQYCF-WDHFKELESLSLQRSMHLAKLVAEM 241 Query: 126 I 124 I Sbjct: 242 I 242 Score = 38.1 bits (87), Expect(3) = 4e-15 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DY+DAFEK+LRLDLSGKQ Sbjct: 155 DYVDAFEKLLRLDLSGKQ 172 Score = 23.9 bits (50), Expect(3) = 4e-15 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRV+V Sbjct: 168 LSGKQDREIMRVVV 181 >ref|XP_018829572.1| PREDICTED: nucleolar MIF4G domain-containing protein 1-like [Juglans regia] Length = 806 Score = 68.9 bits (167), Expect(3) = 4e-15 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EK FNKYYTVLASKLC HDKNHKFTLQ + W + S + R LH Sbjct: 649 CCLQEKVFNKYYTVLASKLCEHDKNHKFTLQFCL-WDHFKELESMQHTRSLH 699 Score = 35.0 bits (79), Expect(3) = 4e-15 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYID FEK+LRLDL GKQ Sbjct: 621 DYIDTFEKLLRLDLHGKQ 638 Score = 24.3 bits (51), Expect(3) = 4e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 634 LHGKQDREIMRVLV 647 >ref|XP_006400338.1| nucleolar MIF4G domain-containing protein 1 [Eutrema salsugineum] gb|ESQ41791.1| hypothetical protein EUTSA_v10012737mg [Eutrema salsugineum] Length = 781 Score = 67.4 bits (163), Expect(3) = 4e-15 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNK+YTVLASK C HDKNHKFTLQ + W + S S R +H Sbjct: 624 CCLQEKAFNKFYTVLASKFCEHDKNHKFTLQYCI-WDHFKELESMSLQRSMH 674 Score = 36.6 bits (83), Expect(3) = 4e-15 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDL GKQ Sbjct: 596 DYIDAFEKLLRLDLPGKQ 613 Score = 24.3 bits (51), Expect(3) = 4e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 609 LPGKQDREIMRVLV 622 >gb|OIT21859.1| hypothetical protein A4A49_35837 [Nicotiana attenuata] Length = 987 Score = 64.3 bits (155), Expect(3) = 6e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNKYY LASKLCSHDKNHKFTLQ + W + S R +H Sbjct: 830 CCLQEKAFNKYYCALASKLCSHDKNHKFTLQYCL-WDHFKELDSMQLIRSMH 880 Score = 38.5 bits (88), Expect(3) = 6e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDLSGKQ Sbjct: 802 DYIDAFEKLLRLDLSGKQ 819 Score = 25.0 bits (53), Expect(3) = 6e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 815 LSGKQDREIMRVLV 828 >ref|XP_019238256.1| PREDICTED: nucleolar MIF4G domain-containing protein 1 [Nicotiana attenuata] Length = 971 Score = 64.3 bits (155), Expect(3) = 6e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNKYY LASKLCSHDKNHKFTLQ + W + S R +H Sbjct: 814 CCLQEKAFNKYYCALASKLCSHDKNHKFTLQYCL-WDHFKELDSMQLIRSMH 864 Score = 38.5 bits (88), Expect(3) = 6e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDLSGKQ Sbjct: 786 DYIDAFEKLLRLDLSGKQ 803 Score = 25.0 bits (53), Expect(3) = 6e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 799 LSGKQDREIMRVLV 812 >ref|XP_009773020.1| PREDICTED: nucleolar MIF4G domain-containing protein 1 [Nicotiana sylvestris] Length = 900 Score = 64.3 bits (155), Expect(3) = 6e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNKYY LASKLCSHDKNHKFTLQ + W + S R +H Sbjct: 739 CCLQEKAFNKYYCALASKLCSHDKNHKFTLQYCL-WDHFKELDSMQLIRSMH 789 Score = 38.5 bits (88), Expect(3) = 6e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDLSGKQ Sbjct: 711 DYIDAFEKLLRLDLSGKQ 728 Score = 25.0 bits (53), Expect(3) = 6e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 724 LSGKQDREIMRVLV 737 >ref|XP_016497732.1| PREDICTED: nucleolar MIF4G domain-containing protein 1-like [Nicotiana tabacum] Length = 803 Score = 64.3 bits (155), Expect(3) = 6e-15 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -2 Query: 306 CCM*EKAFNKYYTVLASKLCSHDKNHKFTLQMIVAWQDSAFIRSASYPRVLH 151 CC+ EKAFNKYY LASKLCSHDKNHKFTLQ + W + S R +H Sbjct: 739 CCLQEKAFNKYYCALASKLCSHDKNHKFTLQYCL-WDHFKELDSMQLIRSMH 789 Score = 38.5 bits (88), Expect(3) = 6e-15 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 395 DYIDAFEKILRLDLSGKQ 342 DYIDAFEK+LRLDLSGKQ Sbjct: 711 DYIDAFEKLLRLDLSGKQ 728 Score = 25.0 bits (53), Expect(3) = 6e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 352 LGNRQDREIMRVLV 311 L +QDREIMRVLV Sbjct: 724 LSGKQDREIMRVLV 737