BLASTX nr result
ID: Ophiopogon26_contig00012867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00012867 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243985.1| cell number regulator 6-like [Asparagus offi... 69 1e-10 ref|XP_010934658.1| PREDICTED: cell number regulator 6-like [Ela... 66 1e-09 ref|XP_008813031.1| PREDICTED: cell number regulator 6-like [Pho... 60 1e-07 gb|OAY65062.1| Cell number regulator 6 [Ananas comosus] 59 2e-07 ref|XP_020114504.1| cell number regulator 6 [Ananas comosus] 59 3e-07 >ref|XP_020243985.1| cell number regulator 6-like [Asparagus officinalis] gb|ONK59142.1| uncharacterized protein A4U43_C08F3420 [Asparagus officinalis] Length = 238 Score = 68.6 bits (166), Expect = 1e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 535 MTVVNPPPVQEMNANENREPEASENGVQSQHATLEIQAL 419 MTVVNPPPVQEMNAN+N+E +ASENG QSQ ATLE+QAL Sbjct: 200 MTVVNPPPVQEMNANDNQESQASENGTQSQRATLEMQAL 238 >ref|XP_010934658.1| PREDICTED: cell number regulator 6-like [Elaeis guineensis] Length = 239 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 535 MTVVNPPPVQEMNANENREPEASENGVQSQHATLEIQAL 419 MT++NPP VQEMNANEN+E +SENGVQ+QHA+LEIQA+ Sbjct: 200 MTIINPPEVQEMNANENKETASSENGVQNQHASLEIQAV 238 >ref|XP_008813031.1| PREDICTED: cell number regulator 6-like [Phoenix dactylifera] Length = 240 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 535 MTVVNPPPVQEMNANENREPEASENGVQSQHATLEIQAL 419 MT++NPP VQEMNANEN+E +SEN VQ+Q A+LEIQA+ Sbjct: 201 MTIINPPAVQEMNANENKETASSENDVQNQQASLEIQAV 239 >gb|OAY65062.1| Cell number regulator 6 [Ananas comosus] Length = 188 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 535 MTVVNPPPVQEMNANENREPEASENGVQSQHATLEIQAL 419 MT++NPP VQEMN NENRE SENGV +QH +EIQ L Sbjct: 150 MTIINPPVVQEMNVNENRESAGSENGVHNQHTEVEIQPL 188 >ref|XP_020114504.1| cell number regulator 6 [Ananas comosus] Length = 238 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 535 MTVVNPPPVQEMNANENREPEASENGVQSQHATLEIQAL 419 MT++NPP VQEMN NENRE SENGV +QH +EIQ L Sbjct: 200 MTIINPPAVQEMNVNENRESAGSENGVHNQHTEVEIQPL 238