BLASTX nr result
ID: Ophiopogon26_contig00012837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00012837 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248741.1| protein BUD31 homolog 2-like [Asparagus offi... 110 2e-28 ref|XP_020108362.1| protein BUD31 homolog 2 [Ananas comosus] >gi... 110 2e-28 ref|XP_020106729.1| protein BUD31 homolog 2-like [Ananas comosus... 110 2e-28 ref|XP_010912251.1| PREDICTED: protein BUD31 homolog 2 [Elaeis g... 110 2e-28 ref|XP_009411965.1| PREDICTED: protein BUD31 homolog 2 [Musa acu... 110 2e-28 ref|XP_021303684.1| protein BUD31 homolog 2 [Sorghum bicolor] >g... 109 4e-28 ref|XP_008783991.1| PREDICTED: protein BUD31 homolog 2 [Phoenix ... 109 4e-28 ref|XP_004961818.1| protein BUD31 homolog 2 [Setaria italica] >g... 109 4e-28 ref|XP_015637596.1| PREDICTED: protein BUD31 homolog 2 [Oryza sa... 109 4e-28 ref|XP_020260311.1| protein BUD31 homolog 2 [Asparagus officinal... 108 6e-28 gb|PKA64301.1| Protein BUD31 like 2 [Apostasia shenzhenica] 108 9e-28 gb|OAY67731.1| Protein BUD 2 [Ananas comosus] 108 9e-28 ref|NP_001148940.1| G10-like protein [Zea mays] >gi|1243938500|r... 108 9e-28 ref|NP_001130110.1| uncharacterized protein LOC100191203 [Zea ma... 108 9e-28 ref|XP_020250555.1| protein BUD31 homolog 2-like [Asparagus offi... 107 1e-27 gb|OVA03612.1| G10 protein [Macleaya cordata] 107 1e-27 gb|PIN00616.1| G10 protein/predicted nuclear transcription regul... 107 2e-27 gb|OWM64868.1| hypothetical protein CDL15_Pgr028585 [Punica gran... 107 2e-27 ref|XP_018839780.1| PREDICTED: protein BUD31 homolog 2 [Juglans ... 107 2e-27 ref|XP_011077892.1| protein BUD31 homolog 2 [Sesamum indicum] >g... 107 2e-27 >ref|XP_020248741.1| protein BUD31 homolog 2-like [Asparagus officinalis] gb|ONK57167.1| uncharacterized protein A4U43_C10F17290 [Asparagus officinalis] Length = 145 Score = 110 bits (275), Expect = 2e-28 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_020108362.1| protein BUD31 homolog 2 [Ananas comosus] ref|XP_020108363.1| protein BUD31 homolog 2 [Ananas comosus] ref|XP_020108364.1| protein BUD31 homolog 2 [Ananas comosus] ref|XP_020108365.1| protein BUD31 homolog 2 [Ananas comosus] ref|XP_020108366.1| protein BUD31 homolog 2 [Ananas comosus] ref|XP_020108367.1| protein BUD31 homolog 2 [Ananas comosus] gb|OAY77506.1| Protein BUD 2 [Ananas comosus] Length = 145 Score = 110 bits (275), Expect = 2e-28 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_020106729.1| protein BUD31 homolog 2-like [Ananas comosus] ref|XP_020106730.1| protein BUD31 homolog 2-like [Ananas comosus] ref|XP_020106731.1| protein BUD31 homolog 2-like [Ananas comosus] gb|OAY63135.1| Protein BUD 2 [Ananas comosus] Length = 145 Score = 110 bits (275), Expect = 2e-28 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_010912251.1| PREDICTED: protein BUD31 homolog 2 [Elaeis guineensis] ref|XP_019704221.1| PREDICTED: protein BUD31 homolog 2 [Elaeis guineensis] Length = 145 Score = 110 bits (275), Expect = 2e-28 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_009411965.1| PREDICTED: protein BUD31 homolog 2 [Musa acuminata subsp. malaccensis] Length = 145 Score = 110 bits (275), Expect = 2e-28 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_021303684.1| protein BUD31 homolog 2 [Sorghum bicolor] ref|XP_021303685.1| protein BUD31 homolog 2 [Sorghum bicolor] ref|XP_021303686.1| protein BUD31 homolog 2 [Sorghum bicolor] gb|KXG22171.1| hypothetical protein SORBI_3009G165800 [Sorghum bicolor] gb|KXG22172.1| hypothetical protein SORBI_3009G165800 [Sorghum bicolor] gb|OQU78145.1| hypothetical protein SORBI_3009G165800 [Sorghum bicolor] gb|OQU78146.1| hypothetical protein SORBI_3009G165800 [Sorghum bicolor] gb|PAN19084.1| hypothetical protein PAHAL_C02684 [Panicum hallii] Length = 145 Score = 109 bits (272), Expect = 4e-28 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLR+LEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRDLEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_008783991.1| PREDICTED: protein BUD31 homolog 2 [Phoenix dactylifera] Length = 145 Score = 109 bits (272), Expect = 4e-28 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLR+LEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRDLEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_004961818.1| protein BUD31 homolog 2 [Setaria italica] ref|XP_004961819.1| protein BUD31 homolog 2 [Setaria italica] ref|XP_012699733.1| protein BUD31 homolog 2 [Setaria italica] gb|KQL15136.1| hypothetical protein SETIT_023567mg [Setaria italica] gb|KQL15137.1| hypothetical protein SETIT_023567mg [Setaria italica] Length = 145 Score = 109 bits (272), Expect = 4e-28 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLR+LEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRDLEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_015637596.1| PREDICTED: protein BUD31 homolog 2 [Oryza sativa Japonica Group] ref|XP_015637597.1| PREDICTED: protein BUD31 homolog 2 [Oryza sativa Japonica Group] sp|Q65WT0.1|BD31B_ORYSJ RecName: Full=Protein BUD31 homolog 2; AltName: Full=Protein G10 homolog 2 gb|AAU44283.1| putative G10 protein [Oryza sativa Japonica Group] dbj|BAF17601.1| Os05g0446300 [Oryza sativa Japonica Group] gb|EAY98233.1| hypothetical protein OsI_20144 [Oryza sativa Indica Group] gb|EEE63899.1| hypothetical protein OsJ_18724 [Oryza sativa Japonica Group] dbj|BAS94283.1| Os05g0446300 [Oryza sativa Japonica Group] Length = 145 Score = 109 bits (272), Expect = 4e-28 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTLR+LEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLRDLEAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_020260311.1| protein BUD31 homolog 2 [Asparagus officinalis] gb|ONK71233.1| uncharacterized protein A4U43_C04F6260 [Asparagus officinalis] Length = 145 Score = 108 bits (271), Expect = 6e-28 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVK+PEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKFPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >gb|PKA64301.1| Protein BUD31 like 2 [Apostasia shenzhenica] Length = 145 Score = 108 bits (270), Expect = 9e-28 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPK+KTSRVKYPEGWELIEPTLRELE KMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKVKTSRVKYPEGWELIEPTLRELEGKMREAENDPHDGKRKCEALWPIF 50 >gb|OAY67731.1| Protein BUD 2 [Ananas comosus] Length = 145 Score = 108 bits (270), Expect = 9e-28 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPTL ELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTLHELEAKMREAENDPHDGKRKCEALWPIF 50 >ref|NP_001148940.1| G10-like protein [Zea mays] ref|NP_001342474.1| protein BUD31 homolog 1 [Zea mays] ref|XP_002458795.2| protein BUD31 homolog 1 [Sorghum bicolor] gb|ACG33554.1| G10-like protein [Zea mays] gb|ACN27111.1| unknown [Zea mays] gb|KXG33729.1| hypothetical protein SORBI_3003G362400 [Sorghum bicolor] gb|AQK99307.1| G10 family protein [Zea mays] gb|AQK99310.1| G10 family protein [Zea mays] Length = 145 Score = 108 bits (270), Expect = 9e-28 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPT+REL+AKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTIRELDAKMREAENDPHDGKRKCEALWPIF 50 >ref|NP_001130110.1| uncharacterized protein LOC100191203 [Zea mays] ref|XP_020406009.1| protein BUD31 homolog 1 [Zea mays] ref|XP_020406010.1| protein BUD31 homolog 1 [Zea mays] gb|ACF78240.1| unknown [Zea mays] gb|ACG33980.1| G10-like protein [Zea mays] gb|ACG36726.1| G10-like protein [Zea mays] gb|ONM36316.1| G10 family protein [Zea mays] gb|ONM36317.1| G10 family protein [Zea mays] Length = 145 Score = 108 bits (270), Expect = 9e-28 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRVKYPEGWELIEPT+REL+AKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVKYPEGWELIEPTIRELDAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_020250555.1| protein BUD31 homolog 2-like [Asparagus officinalis] Length = 104 Score = 107 bits (266), Expect = 1e-27 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKTSRV +PEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTSRVNFPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >gb|OVA03612.1| G10 protein [Macleaya cordata] Length = 123 Score = 107 bits (267), Expect = 1e-27 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPKIKT+RVKYP GWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKIKTNRVKYPNGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 50 >gb|PIN00616.1| G10 protein/predicted nuclear transcription regulator [Handroanthus impetiginosus] gb|PIN16820.1| G10 protein/predicted nuclear transcription regulator [Handroanthus impetiginosus] Length = 145 Score = 107 bits (268), Expect = 2e-27 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPK+KT+RVKYPEGWELIEPTLREL+AKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCEALWPIF 50 >gb|OWM64868.1| hypothetical protein CDL15_Pgr028585 [Punica granatum] gb|PKI56609.1| hypothetical protein CRG98_022992 [Punica granatum] Length = 145 Score = 107 bits (268), Expect = 2e-27 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPK+KTSRV+YPEGWELIEPTLREL+AKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKVKTSRVRYPEGWELIEPTLRELQAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_018839780.1| PREDICTED: protein BUD31 homolog 2 [Juglans regia] ref|XP_018839781.1| PREDICTED: protein BUD31 homolog 2 [Juglans regia] ref|XP_018839783.1| PREDICTED: protein BUD31 homolog 2 [Juglans regia] ref|XP_018839784.1| PREDICTED: protein BUD31 homolog 2 [Juglans regia] ref|XP_018839785.1| PREDICTED: protein BUD31 homolog 2 [Juglans regia] ref|XP_018839786.1| PREDICTED: protein BUD31 homolog 2 [Juglans regia] ref|XP_018839787.1| PREDICTED: protein BUD31 homolog 2 [Juglans regia] Length = 145 Score = 107 bits (268), Expect = 2e-27 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPK+KT+RVKYPEGWELIEPTLREL+AKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCEALWPIF 50 >ref|XP_011077892.1| protein BUD31 homolog 2 [Sesamum indicum] ref|XP_020549283.1| protein BUD31 homolog 2 [Sesamum indicum] Length = 145 Score = 107 bits (268), Expect = 2e-27 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = -2 Query: 151 MPKIKTSRVKYPEGWELIEPTLRELEAKMREAENDPHDGKRKCEALWPIF 2 MPK+KT+RVKYPEGWELIEPTLREL+AKMREAENDPHDGKRKCEALWPIF Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMREAENDPHDGKRKCEALWPIF 50