BLASTX nr result
ID: Ophiopogon26_contig00012681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00012681 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus... 74 1e-12 gb|OIT35126.1| hypothetical protein A4A49_60188, partial [Nicoti... 54 3e-06 >gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus officinalis] Length = 229 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/70 (41%), Positives = 48/70 (68%) Frame = +2 Query: 269 DDPILADCKILLNKLNGPKVSHVFREANQGADLMANIGCVVDNFTVWDNKFPNPLMSIVE 448 D PIL +CK +++ + K+SH+FRE N DL+AN+GC + +W+ + P L++ VE Sbjct: 160 DSPILVNCKSIISSIEEYKISHIFREVNASGDLLANMGCGTTSSILWEFEIPGTLLASVE 219 Query: 449 RDLSGPYLRV 478 RD+ GP++R+ Sbjct: 220 RDMRGPFVRL 229 >gb|OIT35126.1| hypothetical protein A4A49_60188, partial [Nicotiana attenuata] Length = 110 Score = 53.9 bits (128), Expect = 3e-06 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Frame = +2 Query: 278 ILADCKILLNKLNGPKVSHVFREANQGADLMANIGCVVDNFTVWDNKFPNP--LMSIVER 451 ++ DC+ LL K+N P++ HVFREAN ADL+A GC +D F + P ++ +++R Sbjct: 44 LIDDCRYLLRKVNDPQLKHVFREANGVADLLAKNGCSLDTFCILQTYAVPPAFVVHVLKR 103 Query: 452 DLSGPYL 472 D G L Sbjct: 104 DSLGTTL 110