BLASTX nr result
ID: Ophiopogon26_contig00012676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00012676 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264612.1| serrate RNA effector molecule [Asparagus off... 67 3e-10 gb|ONK69550.1| uncharacterized protein A4U43_C05F24150 [Asparagu... 67 3e-10 ref|XP_018683818.1| PREDICTED: serrate RNA effector molecule-lik... 66 1e-09 ref|XP_009403043.1| PREDICTED: serrate RNA effector molecule-lik... 66 1e-09 ref|XP_009381593.1| PREDICTED: serrate RNA effector molecule [Mu... 65 2e-09 ref|XP_009410216.1| PREDICTED: serrate RNA effector molecule iso... 64 5e-09 ref|XP_010929331.1| PREDICTED: serrate RNA effector molecule [El... 64 5e-09 ref|XP_010927259.1| PREDICTED: serrate RNA effector molecule iso... 64 5e-09 ref|XP_008799465.1| PREDICTED: serrate RNA effector molecule [Ph... 64 5e-09 ref|XP_010927258.1| PREDICTED: serrate RNA effector molecule iso... 64 5e-09 ref|XP_020114858.1| serrate RNA effector molecule [Ananas comosu... 62 2e-08 ref|XP_020682721.1| serrate RNA effector molecule [Dendrobium ca... 62 3e-08 ref|XP_019440877.1| PREDICTED: serrate RNA effector molecule-lik... 61 6e-08 gb|OIW13288.1| hypothetical protein TanjilG_25767 [Lupinus angus... 61 6e-08 ref|XP_009401472.1| PREDICTED: serrate RNA effector molecule-lik... 60 9e-08 ref|XP_009401471.1| PREDICTED: serrate RNA effector molecule-lik... 60 9e-08 ref|XP_019199488.1| PREDICTED: serrate RNA effector molecule-lik... 60 9e-08 ref|XP_006848124.1| serrate RNA effector molecule [Amborella tri... 60 9e-08 ref|XP_019199487.1| PREDICTED: serrate RNA effector molecule-lik... 60 9e-08 ref|XP_008349834.1| PREDICTED: serrate RNA effector molecule-lik... 58 9e-08 >ref|XP_020264612.1| serrate RNA effector molecule [Asparagus officinalis] Length = 658 Score = 67.4 bits (163), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P AMRHDPRRIRSYQDLDAPDDEVTVIDYRSL Sbjct: 627 PPAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 658 >gb|ONK69550.1| uncharacterized protein A4U43_C05F24150 [Asparagus officinalis] Length = 704 Score = 67.4 bits (163), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P AMRHDPRRIRSYQDLDAPDDEVTVIDYRSL Sbjct: 673 PPAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 704 >ref|XP_018683818.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 570 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P+A RHDPRRIRSYQDLDAPDDEVTV+DYRSL Sbjct: 539 PSAFRHDPRRIRSYQDLDAPDDEVTVVDYRSL 570 >ref|XP_009403043.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 734 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P+A RHDPRRIRSYQDLDAPDDEVTV+DYRSL Sbjct: 703 PSAFRHDPRRIRSYQDLDAPDDEVTVVDYRSL 734 >ref|XP_009381593.1| PREDICTED: serrate RNA effector molecule [Musa acuminata subsp. malaccensis] Length = 734 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A RHDPRRIRSYQDLDAPDDEVTVIDYRSL Sbjct: 703 PPAFRHDPRRIRSYQDLDAPDDEVTVIDYRSL 734 >ref|XP_009410216.1| PREDICTED: serrate RNA effector molecule isoform X1 [Musa acuminata subsp. malaccensis] Length = 724 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A RHDPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 693 PPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 724 >ref|XP_010929331.1| PREDICTED: serrate RNA effector molecule [Elaeis guineensis] Length = 740 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A RHDPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 709 PPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 740 >ref|XP_010927259.1| PREDICTED: serrate RNA effector molecule isoform X2 [Elaeis guineensis] Length = 746 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A RHDPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 715 PPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 746 >ref|XP_008799465.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera] ref|XP_008799466.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera] Length = 747 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A RHDPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 716 PPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 747 >ref|XP_010927258.1| PREDICTED: serrate RNA effector molecule isoform X1 [Elaeis guineensis] Length = 751 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A RHDPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 720 PPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 751 >ref|XP_020114858.1| serrate RNA effector molecule [Ananas comosus] gb|OAY83351.1| Serrate RNA effector molecule [Ananas comosus] Length = 743 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A +HDPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 712 PPAFQHDPRRIRSYQDLDAPEDEVTVIDYRSL 743 >ref|XP_020682721.1| serrate RNA effector molecule [Dendrobium catenatum] gb|PKU84631.1| Serrate RNA effector molecule [Dendrobium catenatum] Length = 703 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A RHDPRR+RSYQDLDAP+DEVTV+DYRSL Sbjct: 672 PPAFRHDPRRMRSYQDLDAPEDEVTVMDYRSL 703 >ref|XP_019440877.1| PREDICTED: serrate RNA effector molecule-like [Lupinus angustifolius] Length = 703 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A R DPRR+RSYQDLDAPDDEVTVIDYRSL Sbjct: 672 PPAFRADPRRLRSYQDLDAPDDEVTVIDYRSL 703 >gb|OIW13288.1| hypothetical protein TanjilG_25767 [Lupinus angustifolius] Length = 715 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P A R DPRR+RSYQDLDAPDDEVTVIDYRSL Sbjct: 684 PPAFRADPRRLRSYQDLDAPDDEVTVIDYRSL 715 >ref|XP_009401472.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 730 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 8 AMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 A RHDPRRIRSYQDLDAP+D+VTVIDYRSL Sbjct: 701 AFRHDPRRIRSYQDLDAPEDDVTVIDYRSL 730 >ref|XP_009401471.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 735 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 8 AMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 A RHDPRRIRSYQDLDAP+D+VTVIDYRSL Sbjct: 706 AFRHDPRRIRSYQDLDAPEDDVTVIDYRSL 735 >ref|XP_019199488.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Ipomoea nil] Length = 736 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P ++R DPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 705 PPSLRQDPRRIRSYQDLDAPEDEVTVIDYRSL 736 >ref|XP_006848124.1| serrate RNA effector molecule [Amborella trichopoda] gb|ERN09705.1| hypothetical protein AMTR_s00029p00219930 [Amborella trichopoda] Length = 739 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 8 AMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 A RHDPRR+RSYQDLDAP+DEVTVIDYRSL Sbjct: 710 AFRHDPRRMRSYQDLDAPEDEVTVIDYRSL 739 >ref|XP_019199487.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Ipomoea nil] Length = 740 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 PTAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 P ++R DPRRIRSYQDLDAP+DEVTVIDYRSL Sbjct: 709 PPSLRQDPRRIRSYQDLDAPEDEVTVIDYRSL 740 >ref|XP_008349834.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica] ref|XP_008349835.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica] ref|XP_008366392.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica] ref|XP_008366393.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica] Length = 134 Score = 57.8 bits (138), Expect = 9e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 8 AMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 97 A R DPRR+RSYQDLDAP+DEVTVIDYRSL Sbjct: 105 AFRQDPRRLRSYQDLDAPEDEVTVIDYRSL 134