BLASTX nr result
ID: Ophiopogon26_contig00011731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00011731 (934 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010274512.1| PREDICTED: calcineurin B-like protein 1 [Nel... 59 2e-06 >ref|XP_010274512.1| PREDICTED: calcineurin B-like protein 1 [Nelumbo nucifera] Length = 213 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 844 MGCFPSKSRKHFRGYEDPVLLASQTAFSVS 933 MGC+ SKSRKHFRG+EDPV+LASQTAFSVS Sbjct: 1 MGCYTSKSRKHFRGHEDPVILASQTAFSVS 30