BLASTX nr result
ID: Ophiopogon26_contig00011545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00011545 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79610.1| uncharacterized protein A4U43_C01F8120 [Asparagus... 59 7e-08 ref|XP_020277146.1| uncharacterized protein LOC109851425 [Aspara... 58 9e-08 >gb|ONK79610.1| uncharacterized protein A4U43_C01F8120 [Asparagus officinalis] Length = 280 Score = 59.3 bits (142), Expect = 7e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 3 PVQNSHLAMSHDSSVLAVELDVEEMAKSTKI 95 PVQNSH+AMSHDSSVLAVELDV+EMA+STKI Sbjct: 175 PVQNSHMAMSHDSSVLAVELDVDEMARSTKI 205 >ref|XP_020277146.1| uncharacterized protein LOC109851425 [Asparagus officinalis] Length = 205 Score = 58.2 bits (139), Expect = 9e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 PVQNSHLAMSHDSSVLAVELDVEEMAKSTKI 95 PVQNSH+AMSHDSSVLAVELDV+EMA+STK+ Sbjct: 175 PVQNSHMAMSHDSSVLAVELDVDEMARSTKM 205