BLASTX nr result
ID: Ophiopogon26_contig00010958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00010958 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259149.1| calcium uptake protein, mitochondrial-like, ... 77 4e-14 gb|EMS64759.1| Calcium uptake protein 1, mitochondrial [Triticum... 71 6e-12 ref|XP_003572710.2| PREDICTED: calcium uptake protein 1 homolog,... 71 7e-12 dbj|BAK07466.1| predicted protein, partial [Hordeum vulgare subs... 71 7e-12 ref|XP_020192300.1| calcium uptake protein, mitochondrial-like [... 71 7e-12 ref|XP_021318893.1| calcium uptake protein, mitochondrial [Sorgh... 71 9e-12 gb|ONM16134.1| calcium-binding EF hand family protein [Zea mays] 67 2e-11 ref|XP_004976139.1| calcium uptake protein, mitochondrial [Setar... 69 4e-11 gb|KQK97963.1| hypothetical protein SETIT_0097791mg, partial [Se... 69 6e-11 gb|OEL21857.1| Calcium uptake protein 1, mitochondrial [Dichanth... 69 6e-11 gb|PAN38964.1| hypothetical protein PAHAL_H00679 [Panicum hallii] 68 8e-11 ref|XP_008645921.1| calcium uptake protein, mitochondrial [Zea m... 68 1e-10 gb|ONM16143.1| calcium-binding EF hand family protein [Zea mays]... 67 1e-10 gb|ONM16133.1| calcium-binding EF hand family protein [Zea mays]... 67 1e-10 gb|ONM16135.1| calcium-binding EF hand family protein [Zea mays] 67 2e-10 gb|ONM16148.1| calcium-binding EF hand family protein [Zea mays] 67 2e-10 gb|ONM16140.1| calcium-binding EF hand family protein [Zea mays] 67 3e-10 ref|XP_008668320.1| uncharacterized protein LOC100382185 isoform... 67 3e-10 gb|ONM16151.1| calcium-binding EF hand family protein [Zea mays] 67 3e-10 gb|ONM16132.1| calcium-binding EF hand family protein [Zea mays]... 67 3e-10 >ref|XP_020259149.1| calcium uptake protein, mitochondrial-like, partial [Asparagus officinalis] Length = 390 Score = 77.4 bits (189), Expect = 4e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIGR 243 +DV+FH+FDTN DG+LSSEEFLR MQ+RE+DI HPTVPGL+GR Sbjct: 329 VDVIFHVFDTNRDGNLSSEEFLRAMQKREDDIRHPTVPGLLGR 371 >gb|EMS64759.1| Calcium uptake protein 1, mitochondrial [Triticum urartu] Length = 391 Score = 71.2 bits (173), Expect = 6e-12 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +DV+FH+FD NCDG+LSSEEFLR +QRRE++I PT PGL+G Sbjct: 341 VDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMG 382 >ref|XP_003572710.2| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like [Brachypodium distachyon] gb|KQK00313.1| hypothetical protein BRADI_3g48610v3 [Brachypodium distachyon] Length = 456 Score = 71.2 bits (173), Expect = 7e-12 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +DV+FH+FD NCDG+LSSEEFLR +QRRE++I PT PGL+G Sbjct: 396 VDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMG 437 >dbj|BAK07466.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 508 Score = 71.2 bits (173), Expect = 7e-12 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +DV+FH+FD NCDG+LSSEEFLR +QRRE++I PT PGL+G Sbjct: 448 VDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMG 489 >ref|XP_020192300.1| calcium uptake protein, mitochondrial-like [Aegilops tauschii subsp. tauschii] Length = 510 Score = 71.2 bits (173), Expect = 7e-12 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +DV+FH+FD NCDG+LSSEEFLR +QRRE++I PT PGL+G Sbjct: 450 VDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMG 491 >ref|XP_021318893.1| calcium uptake protein, mitochondrial [Sorghum bicolor] gb|KXG26657.1| hypothetical protein SORBI_3006G138300 [Sorghum bicolor] Length = 467 Score = 70.9 bits (172), Expect = 9e-12 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LSSEEFLR +QRRENDI PT+PG +G Sbjct: 407 VDIIFHVFDTNQDGNLSSEEFLRALQRRENDIRQPTIPGPLG 448 >gb|ONM16134.1| calcium-binding EF hand family protein [Zea mays] Length = 145 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 85 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 126 >ref|XP_004976139.1| calcium uptake protein, mitochondrial [Setaria italica] ref|XP_022684335.1| calcium uptake protein, mitochondrial [Setaria italica] Length = 328 Score = 68.6 bits (166), Expect = 4e-11 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LSSEEFLR +QRRE DI PT+PG +G Sbjct: 268 VDIIFHVFDTNQDGNLSSEEFLRALQRRETDIRQPTIPGPLG 309 >gb|KQK97963.1| hypothetical protein SETIT_0097791mg, partial [Setaria italica] Length = 450 Score = 68.6 bits (166), Expect = 6e-11 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LSSEEFLR +QRRE DI PT+PG +G Sbjct: 390 VDIIFHVFDTNQDGNLSSEEFLRALQRRETDIRQPTIPGPLG 431 >gb|OEL21857.1| Calcium uptake protein 1, mitochondrial [Dichanthelium oligosanthes] Length = 464 Score = 68.6 bits (166), Expect = 6e-11 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LSSEEFLR +QRRE DI PT+PG +G Sbjct: 405 VDIIFHVFDTNQDGNLSSEEFLRALQRRETDIRQPTIPGPLG 446 >gb|PAN38964.1| hypothetical protein PAHAL_H00679 [Panicum hallii] Length = 469 Score = 68.2 bits (165), Expect = 8e-11 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LSSEEFLR +QRRE DI PT+PG +G Sbjct: 409 LDIIFHVFDTNQDGNLSSEEFLRALQRRETDIRQPTIPGPLG 450 >ref|XP_008645921.1| calcium uptake protein, mitochondrial [Zea mays] gb|AQK72574.1| calcium-binding EF hand family protein [Zea mays] Length = 463 Score = 67.8 bits (164), Expect = 1e-10 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FD NCDG+LSSEEFLR +QRRENDI P G +G Sbjct: 403 VDIIFHVFDANCDGNLSSEEFLRSLQRRENDIRQPATSGFLG 444 >gb|ONM16143.1| calcium-binding EF hand family protein [Zea mays] gb|ONM16144.1| calcium-binding EF hand family protein [Zea mays] gb|ONM16145.1| calcium-binding EF hand family protein [Zea mays] Length = 246 Score = 66.6 bits (161), Expect = 1e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 186 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 227 >gb|ONM16133.1| calcium-binding EF hand family protein [Zea mays] gb|ONM16139.1| calcium-binding EF hand family protein [Zea mays] Length = 257 Score = 66.6 bits (161), Expect = 1e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 197 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 238 >gb|ONM16135.1| calcium-binding EF hand family protein [Zea mays] Length = 273 Score = 66.6 bits (161), Expect = 2e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 213 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 254 >gb|ONM16148.1| calcium-binding EF hand family protein [Zea mays] Length = 279 Score = 66.6 bits (161), Expect = 2e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 219 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 260 >gb|ONM16140.1| calcium-binding EF hand family protein [Zea mays] Length = 383 Score = 66.6 bits (161), Expect = 3e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 323 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 364 >ref|XP_008668320.1| uncharacterized protein LOC100382185 isoform X1 [Zea mays] gb|ONM16153.1| calcium-binding EF hand family protein [Zea mays] gb|ONM16154.1| calcium-binding EF hand family protein [Zea mays] Length = 458 Score = 66.6 bits (161), Expect = 3e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 398 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 439 >gb|ONM16151.1| calcium-binding EF hand family protein [Zea mays] Length = 494 Score = 66.6 bits (161), Expect = 3e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 435 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 476 >gb|ONM16132.1| calcium-binding EF hand family protein [Zea mays] gb|ONM16136.1| calcium-binding EF hand family protein [Zea mays] Length = 495 Score = 66.6 bits (161), Expect = 3e-10 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 371 IDVVFHIFDTNCDGHLSSEEFLRVMQRRENDISHPTVPGLIG 246 +D++FH+FDTN DG+LS EEFLR +QRRE DI PT+PG +G Sbjct: 435 VDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLG 476