BLASTX nr result
ID: Ophiopogon26_contig00010922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00010922 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265558.1| protein RER1A-like [Asparagus officinalis] >... 90 3e-19 ref|XP_003524658.1| PREDICTED: protein RER1A-like [Glycine max] ... 89 4e-19 ref|XP_009396419.1| PREDICTED: protein RER1A-like [Musa acuminat... 89 6e-19 ref|XP_009395853.1| PREDICTED: protein RER1A-like [Musa acuminat... 89 7e-19 ref|XP_009619624.1| PREDICTED: protein RER1A-like [Nicotiana tom... 88 1e-18 gb|KHN27074.1| Protein RER1A, partial [Glycine soja] 87 1e-18 gb|KHN42107.1| Protein RER1A [Glycine soja] 87 1e-18 gb|KHN36256.1| Protein RER1A [Glycine soja] 87 1e-18 ref|XP_008799708.1| PREDICTED: protein RER1A-like [Phoenix dacty... 88 2e-18 gb|KRH28427.1| hypothetical protein GLYMA_11G052800 [Glycine max] 87 2e-18 ref|XP_003550042.1| PREDICTED: protein RER1A-like [Glycine max] ... 87 2e-18 ref|XP_024180808.1| protein RER1A-like [Rosa chinensis] >gi|1358... 87 2e-18 ref|XP_019264729.1| PREDICTED: protein RER1A-like [Nicotiana att... 87 2e-18 ref|XP_020202432.1| protein RER1A-like isoform X2 [Cajanus cajan] 87 2e-18 ref|XP_022132445.1| protein RER1A-like [Momordica charantia] >gi... 87 2e-18 dbj|GAU38284.1| hypothetical protein TSUD_157690 [Trifolium subt... 87 2e-18 gb|AFK39450.1| unknown [Lotus japonicus] 87 2e-18 ref|XP_020202431.1| protein RER1A-like isoform X1 [Cajanus cajan... 87 2e-18 gb|KOM44996.1| hypothetical protein LR48_Vigan06g030200 [Vigna a... 87 2e-18 ref|XP_007156766.1| hypothetical protein PHAVU_002G015800g [Phas... 87 2e-18 >ref|XP_020265558.1| protein RER1A-like [Asparagus officinalis] gb|ONK70296.1| uncharacterized protein A4U43_C05F32270 [Asparagus officinalis] Length = 209 Score = 89.7 bits (221), Expect = 3e-19 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAF+LTFF AFDVPVFWPILVFYWFVL Sbjct: 124 PFVRRLPEFKFWYSITKAFCIAFILTFFDAFDVPVFWPILVFYWFVL 170 >ref|XP_003524658.1| PREDICTED: protein RER1A-like [Glycine max] gb|KHN12822.1| Protein RER1A [Glycine soja] gb|KRH57969.1| hypothetical protein GLYMA_05G096900 [Glycine max] Length = 198 Score = 89.4 bits (220), Expect = 4e-19 Identities = 43/77 (55%), Positives = 48/77 (62%), Gaps = 10/77 (12%) Frame = +3 Query: 270 GDLQPSAAPPSTLIRCQAPP----------PFRPSTPRVKFWYSITKAFCIAFVLTFFSA 419 G L P P + ++ P PF P KFWYSITKAFCIAFV+TFFSA Sbjct: 80 GFLSPQVDPETVILDADVPTLPSTASDEFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSA 139 Query: 420 FDVPVFWPILVFYWFVL 470 FDVPVFWPIL+FYW VL Sbjct: 140 FDVPVFWPILLFYWVVL 156 >ref|XP_009396419.1| PREDICTED: protein RER1A-like [Musa acuminata subsp. malaccensis] Length = 203 Score = 89.0 bits (219), Expect = 6e-19 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFVLTFFS FDVPVFWPIL+FYWFVL Sbjct: 114 PFVRRLPEFKFWYSITKAFCIAFVLTFFSVFDVPVFWPILLFYWFVL 160 >ref|XP_009395853.1| PREDICTED: protein RER1A-like [Musa acuminata subsp. malaccensis] Length = 200 Score = 88.6 bits (218), Expect = 7e-19 Identities = 42/69 (60%), Positives = 49/69 (71%), Gaps = 3/69 (4%) Frame = +3 Query: 273 DLQPSAAPPSTLIRCQAPPPFRPST---PRVKFWYSITKAFCIAFVLTFFSAFDVPVFWP 443 ++Q A P + ++ FRP P KFW+SITKAFCIAFVLTFFSAFDVPVFWP Sbjct: 89 EIQDLVAGPGPSLPTRSSDEFRPFVRRLPEFKFWHSITKAFCIAFVLTFFSAFDVPVFWP 148 Query: 444 ILVFYWFVL 470 IL+FYW VL Sbjct: 149 ILLFYWLVL 157 >ref|XP_009619624.1| PREDICTED: protein RER1A-like [Nicotiana tomentosiformis] ref|XP_016457496.1| PREDICTED: protein RER1A-like [Nicotiana tabacum] Length = 202 Score = 88.2 bits (217), Expect = 1e-18 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFVLTFFSAFDVPVFWPIL+FYW VL Sbjct: 114 PFVRRLPEFKFWYSITKAFCIAFVLTFFSAFDVPVFWPILLFYWIVL 160 >gb|KHN27074.1| Protein RER1A, partial [Glycine soja] Length = 176 Score = 87.4 bits (215), Expect = 1e-18 Identities = 42/77 (54%), Positives = 47/77 (61%), Gaps = 10/77 (12%) Frame = +3 Query: 270 GDLQPSAAPPSTLIRCQAP----------PPFRPSTPRVKFWYSITKAFCIAFVLTFFSA 419 G L P P + ++ P PF P KFWYSITKAFCIAFV+TFFS Sbjct: 56 GFLSPQVDPETAILNADDPILPIAASDEFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSV 115 Query: 420 FDVPVFWPILVFYWFVL 470 FDVPVFWPIL+FYW VL Sbjct: 116 FDVPVFWPILLFYWVVL 132 >gb|KHN42107.1| Protein RER1A [Glycine soja] Length = 163 Score = 87.0 bits (214), Expect = 1e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 76 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 122 >gb|KHN36256.1| Protein RER1A [Glycine soja] Length = 163 Score = 87.0 bits (214), Expect = 1e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 76 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 122 >ref|XP_008799708.1| PREDICTED: protein RER1A-like [Phoenix dactylifera] Length = 204 Score = 87.8 bits (216), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAF+LTFFSAFDVPVFWPIL+FYW VL Sbjct: 113 PFVRRLPEFKFWYSITKAFCIAFILTFFSAFDVPVFWPILLFYWLVL 159 >gb|KRH28427.1| hypothetical protein GLYMA_11G052800 [Glycine max] Length = 191 Score = 87.4 bits (215), Expect = 2e-18 Identities = 44/70 (62%), Positives = 47/70 (67%), Gaps = 7/70 (10%) Frame = +3 Query: 282 PSAAPPSTLIRCQAPPP----FRPST---PRVKFWYSITKAFCIAFVLTFFSAFDVPVFW 440 P P + R P P FRP P KFWYSITKAFCIAFV+TFFSAFDVPVFW Sbjct: 81 PLQVDPEIIGRPHPPHPRIRQFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFW 140 Query: 441 PILVFYWFVL 470 PIL+FYW VL Sbjct: 141 PILLFYWVVL 150 >ref|XP_003550042.1| PREDICTED: protein RER1A-like [Glycine max] gb|KRH04536.1| hypothetical protein GLYMA_17G168200 [Glycine max] Length = 197 Score = 87.4 bits (215), Expect = 2e-18 Identities = 42/77 (54%), Positives = 47/77 (61%), Gaps = 10/77 (12%) Frame = +3 Query: 270 GDLQPSAAPPSTLIRCQAP----------PPFRPSTPRVKFWYSITKAFCIAFVLTFFSA 419 G L P P + ++ P PF P KFWYSITKAFCIAFV+TFFS Sbjct: 77 GFLSPQVDPETAILNADDPILPIAASDEFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSV 136 Query: 420 FDVPVFWPILVFYWFVL 470 FDVPVFWPIL+FYW VL Sbjct: 137 FDVPVFWPILLFYWVVL 153 >ref|XP_024180808.1| protein RER1A-like [Rosa chinensis] gb|PRQ48055.1| putative retrieval of early ER protein Rer1 [Rosa chinensis] Length = 199 Score = 87.4 bits (215), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 118 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWLVL 164 >ref|XP_019264729.1| PREDICTED: protein RER1A-like [Nicotiana attenuata] gb|OIT36223.1| protein rer1a [Nicotiana attenuata] Length = 202 Score = 87.4 bits (215), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P +KFWYSITKAFCIAF LTFFSAFDVPVFWPIL+FYW VL Sbjct: 114 PFVRRLPELKFWYSITKAFCIAFALTFFSAFDVPVFWPILLFYWIVL 160 >ref|XP_020202432.1| protein RER1A-like isoform X2 [Cajanus cajan] Length = 188 Score = 87.0 bits (214), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 103 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 149 >ref|XP_022132445.1| protein RER1A-like [Momordica charantia] ref|XP_022132446.1| protein RER1A-like [Momordica charantia] ref|XP_022132447.1| protein RER1A-like [Momordica charantia] Length = 205 Score = 87.4 bits (215), Expect = 2e-18 Identities = 40/66 (60%), Positives = 44/66 (66%) Frame = +3 Query: 273 DLQPSAAPPSTLIRCQAPPPFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILV 452 DL P + PF P KFWYSITKAFCIAF++TFFSAFDVPVFWPIL+ Sbjct: 97 DLHEGTGPALPISESDEFRPFVRRLPEFKFWYSITKAFCIAFLMTFFSAFDVPVFWPILL 156 Query: 453 FYWFVL 470 FYW VL Sbjct: 157 FYWVVL 162 >dbj|GAU38284.1| hypothetical protein TSUD_157690 [Trifolium subterraneum] Length = 190 Score = 87.0 bits (214), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 104 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 150 >gb|AFK39450.1| unknown [Lotus japonicus] Length = 191 Score = 87.0 bits (214), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 103 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 149 >ref|XP_020202431.1| protein RER1A-like isoform X1 [Cajanus cajan] gb|KYP40214.1| Protein RER1A [Cajanus cajan] Length = 191 Score = 87.0 bits (214), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 103 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 149 >gb|KOM44996.1| hypothetical protein LR48_Vigan06g030200 [Vigna angularis] Length = 191 Score = 87.0 bits (214), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 104 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 150 >ref|XP_007156766.1| hypothetical protein PHAVU_002G015800g [Phaseolus vulgaris] gb|ESW28760.1| hypothetical protein PHAVU_002G015800g [Phaseolus vulgaris] Length = 191 Score = 87.0 bits (214), Expect = 2e-18 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 330 PFRPSTPRVKFWYSITKAFCIAFVLTFFSAFDVPVFWPILVFYWFVL 470 PF P KFWYSITKAFCIAFV+TFFSAFDVPVFWPIL+FYW VL Sbjct: 104 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVL 150