BLASTX nr result
ID: Ophiopogon26_contig00010857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00010857 (748 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245400.1| meiotic recombination protein SPO11-2 isofor... 70 3e-10 ref|XP_020245397.1| meiotic recombination protein SPO11-2 isofor... 70 3e-10 gb|PKA50130.1| Meiotic recombination protein SPO11-2 [Apostasia ... 66 9e-09 ref|XP_020114836.1| meiotic recombination protein SPO11-2 isofor... 63 6e-08 ref|XP_020114835.1| meiotic recombination protein SPO11-2 isofor... 63 1e-07 ref|XP_018676847.1| PREDICTED: meiotic recombination protein SPO... 59 3e-06 ref|XP_009385844.2| PREDICTED: meiotic recombination protein SPO... 59 3e-06 ref|XP_018676844.1| PREDICTED: meiotic recombination protein SPO... 59 3e-06 ref|XP_018676843.1| PREDICTED: meiotic recombination protein SPO... 59 3e-06 ref|XP_009385843.2| PREDICTED: meiotic recombination protein SPO... 59 3e-06 ref|XP_020579267.1| meiotic recombination protein SPO11-2-like [... 57 3e-06 ref|XP_019160406.1| PREDICTED: meiotic recombination protein SPO... 58 5e-06 >ref|XP_020245400.1| meiotic recombination protein SPO11-2 isoform X2 [Asparagus officinalis] Length = 377 Score = 70.5 bits (171), Expect = 3e-10 Identities = 39/57 (68%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISKTS 667 +LPK SL FADQRLCSA I+PP QV+ R++V V FLKSLAS T IS LPLIS+TS Sbjct: 4 SLPKSSLFFADQRLCSADILPPSQVRARLEVAVLNFLKSLASPTPAISDLPLISRTS 60 >ref|XP_020245397.1| meiotic recombination protein SPO11-2 isoform X1 [Asparagus officinalis] gb|ONK80226.1| uncharacterized protein A4U43_C01F15310 [Asparagus officinalis] Length = 382 Score = 70.5 bits (171), Expect = 3e-10 Identities = 39/57 (68%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISKTS 667 +LPK SL FADQRLCSA I+PP QV+ R++V V FLKSLAS T IS LPLIS+TS Sbjct: 4 SLPKSSLFFADQRLCSADILPPSQVRARLEVAVLNFLKSLASPTPAISDLPLISRTS 60 >gb|PKA50130.1| Meiotic recombination protein SPO11-2 [Apostasia shenzhenica] Length = 370 Score = 65.9 bits (159), Expect = 9e-09 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAII-PPQVQPRIKVVVHKFLKSLASSTLIISHLPLISKTSTMA 676 N PK +L +DQRLCSA I+ PPQV RIKV V F+++L+SST ISHLPLI++T + + Sbjct: 4 NFPKSTLFSSDQRLCSAQILDPPQVNARIKVAVLSFIRTLSSSTPEISHLPLINRTPSNS 63 Query: 677 HL 682 L Sbjct: 64 GL 65 >ref|XP_020114836.1| meiotic recombination protein SPO11-2 isoform X2 [Ananas comosus] Length = 270 Score = 62.8 bits (151), Expect = 6e-08 Identities = 34/57 (59%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISKTS 667 +L K SL +ADQRLCSA I+PP QV+ RI+V V FLK+L+S+T IS+LP+IS+ S Sbjct: 4 DLIKSSLFYADQRLCSAEILPPPQVRARIEVAVLNFLKALSSTTPAISNLPMISRRS 60 >ref|XP_020114835.1| meiotic recombination protein SPO11-2 isoform X1 [Ananas comosus] Length = 382 Score = 62.8 bits (151), Expect = 1e-07 Identities = 34/57 (59%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISKTS 667 +L K SL +ADQRLCSA I+PP QV+ RI+V V FLK+L+S+T IS+LP+IS+ S Sbjct: 4 DLIKSSLFYADQRLCSAEILPPPQVRARIEVAVLNFLKALSSTTPAISNLPMISRRS 60 >ref|XP_018676847.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X8 [Musa acuminata subsp. malaccensis] Length = 352 Score = 58.5 bits (140), Expect = 3e-06 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 4/72 (5%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISK---TS 667 +L K SL ADQRLCSA I+PP QV+ RI+V V FLK+L +S IS LPLIS+ S Sbjct: 59 DLLKSSLFHADQRLCSAEILPPSQVRARIEVAVLNFLKNLTASNPAISDLPLISRKYDNS 118 Query: 668 TMAHLILQVVAT 703 + H +L V++ Sbjct: 119 GLRHGLLSDVSS 130 >ref|XP_009385844.2| PREDICTED: meiotic recombination protein SPO11-2 isoform X4 [Musa acuminata subsp. malaccensis] Length = 437 Score = 58.5 bits (140), Expect = 3e-06 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 4/72 (5%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISK---TS 667 +L K SL ADQRLCSA I+PP QV+ RI+V V FLK+L +S IS LPLIS+ S Sbjct: 59 DLLKSSLFHADQRLCSAEILPPSQVRARIEVAVLNFLKNLTASNPAISDLPLISRKYDNS 118 Query: 668 TMAHLILQVVAT 703 + H +L V++ Sbjct: 119 GLRHGLLSDVSS 130 >ref|XP_018676844.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X3 [Musa acuminata subsp. malaccensis] Length = 452 Score = 58.5 bits (140), Expect = 3e-06 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 4/72 (5%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISK---TS 667 +L K SL ADQRLCSA I+PP QV+ RI+V V FLK+L +S IS LPLIS+ S Sbjct: 59 DLLKSSLFHADQRLCSAEILPPSQVRARIEVAVLNFLKNLTASNPAISDLPLISRKYDNS 118 Query: 668 TMAHLILQVVAT 703 + H +L V++ Sbjct: 119 GLRHGLLSDVSS 130 >ref|XP_018676843.1| PREDICTED: meiotic recombination protein SPO11-2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 452 Score = 58.5 bits (140), Expect = 3e-06 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 4/72 (5%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISK---TS 667 +L K SL ADQRLCSA I+PP QV+ RI+V V FLK+L +S IS LPLIS+ S Sbjct: 59 DLLKSSLFHADQRLCSAEILPPSQVRARIEVAVLNFLKNLTASNPAISDLPLISRKYDNS 118 Query: 668 TMAHLILQVVAT 703 + H +L V++ Sbjct: 119 GLRHGLLSDVSS 130 >ref|XP_009385843.2| PREDICTED: meiotic recombination protein SPO11-2 isoform X1 [Musa acuminata subsp. malaccensis] Length = 457 Score = 58.5 bits (140), Expect = 3e-06 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 4/72 (5%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISK---TS 667 +L K SL ADQRLCSA I+PP QV+ RI+V V FLK+L +S IS LPLIS+ S Sbjct: 59 DLLKSSLFHADQRLCSAEILPPSQVRARIEVAVLNFLKNLTASNPAISDLPLISRKYDNS 118 Query: 668 TMAHLILQVVAT 703 + H +L V++ Sbjct: 119 GLRHGLLSDVSS 130 >ref|XP_020579267.1| meiotic recombination protein SPO11-2-like [Phalaenopsis equestris] Length = 180 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISKTSTMA 676 + PK SL +DQRLCSA ++ P QV+ RI+V V KFL +L+S T IS LPLI + S+ + Sbjct: 4 DFPKSSLFSSDQRLCSAQVLDPSQVRARIEVAVLKFLNALSSPTPAISFLPLICRKSSNS 63 Query: 677 HL 682 L Sbjct: 64 GL 65 >ref|XP_019160406.1| PREDICTED: meiotic recombination protein SPO11-2 [Ipomoea nil] Length = 383 Score = 57.8 bits (138), Expect = 5e-06 Identities = 32/57 (56%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = +2 Query: 500 NLPKPSLLFADQRLCSAAIIPP-QVQPRIKVVVHKFLKSLASSTLIISHLPLISKTS 667 +L K S+ F+DQ LC A I+PP QV+ RI+V V FLK+L+S T IS+LPLIS+ S Sbjct: 3 DLSKSSIFFSDQHLCYADILPPLQVRARIEVAVLNFLKALSSPTPSISNLPLISRKS 59