BLASTX nr result
ID: Ophiopogon26_contig00010698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00010698 (646 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75144.1| uncharacterized protein A4U43_C03F13820 [Asparagu... 66 3e-09 ref|XP_020256975.1| RING-H2 finger protein ATL2-like [Asparagus ... 66 3e-09 >gb|ONK75144.1| uncharacterized protein A4U43_C03F13820 [Asparagus officinalis] Length = 263 Score = 65.9 bits (159), Expect = 3e-09 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -2 Query: 645 EEIKSPVAFGRMKSLKRILSRGRASFKGTSSSSYGPIGCDIEEGGLADSKCQ 490 EEIKSPV GRMKSLKR+LSRGR SFKG +SY +G DIE+GG++D KC+ Sbjct: 214 EEIKSPV-MGRMKSLKRMLSRGRMSFKGV-GTSYTSMGSDIEQGGVSDYKCR 263 >ref|XP_020256975.1| RING-H2 finger protein ATL2-like [Asparagus officinalis] Length = 286 Score = 65.9 bits (159), Expect = 3e-09 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -2 Query: 645 EEIKSPVAFGRMKSLKRILSRGRASFKGTSSSSYGPIGCDIEEGGLADSKCQ 490 EEIKSPV GRMKSLKR+LSRGR SFKG +SY +G DIE+GG++D KC+ Sbjct: 237 EEIKSPV-MGRMKSLKRMLSRGRMSFKGV-GTSYTSMGSDIEQGGVSDYKCR 286