BLASTX nr result
ID: Ophiopogon26_contig00010676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00010676 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261505.1| probable E3 ubiquitin-protein ligase ARI8 [A... 64 2e-09 >ref|XP_020261505.1| probable E3 ubiquitin-protein ligase ARI8 [Asparagus officinalis] gb|ONK72465.1| uncharacterized protein A4U43_C04F19720 [Asparagus officinalis] Length = 584 Score = 63.9 bits (154), Expect = 2e-09 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 282 TITCADYEDWRCAHCTYVNPKTTDVCEMCENY 187 T+T ADYEDWRC+HCT+VNPKTTD C CEN+ Sbjct: 552 TVTEADYEDWRCSHCTFVNPKTTDTCGACENH 583