BLASTX nr result
ID: Ophiopogon26_contig00009753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00009753 (682 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240861.1| scarecrow-like protein 6 [Asparagus officina... 57 8e-06 >ref|XP_020240861.1| scarecrow-like protein 6 [Asparagus officinalis] Length = 600 Score = 57.0 bits (136), Expect = 8e-06 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -1 Query: 352 MPCTQFQSQGVLQADETANFWSNKKRKGVSSI-EPTSVLDKRR 227 MP TQ QSQGV + + A+FWSNKKRK V+ + EPTSVLDKRR Sbjct: 1 MPFTQIQSQGVEEHEIRADFWSNKKRKAVAGLREPTSVLDKRR 43