BLASTX nr result
ID: Ophiopogon26_contig00009650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00009650 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65391.1| uncharacterized protein A4U43_C07F36620 [Asparagu... 64 3e-09 >gb|ONK65391.1| uncharacterized protein A4U43_C07F36620 [Asparagus officinalis] Length = 292 Score = 63.9 bits (154), Expect = 3e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 435 PPWLELPDGVTELIVERLPLYEYVRFAAVCRQWRSIQRAHR 313 PPWL+LPD TELI++RLPL +Y+RFA VC +W+SIQ HR Sbjct: 162 PPWLDLPDLATELILQRLPLPDYIRFADVCIKWQSIQNNHR 202