BLASTX nr result
ID: Ophiopogon26_contig00009611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00009611 (672 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59206.1| uncharacterized protein A4U43_C08F4070 [Asparagus... 69 9e-12 gb|PNX79520.1| cell division protein ftsy chloroplastic-like, pa... 67 1e-10 ref|XP_020277218.1| LOW QUALITY PROTEIN: cell division protein F... 69 2e-10 ref|XP_006386593.1| hypothetical protein POPTR_0002s15680g, part... 67 5e-10 ref|XP_011023398.1| PREDICTED: cell division protein FtsY homolo... 64 6e-10 ref|XP_013444937.1| signal recognition particle protein [Medicag... 67 7e-10 gb|OAY69661.1| Cell division protein FtsY, chloroplastic, partia... 68 7e-10 ref|XP_020114749.1| cell division protein FtsY homolog, chloropl... 68 9e-10 ref|XP_020699755.1| cell division protein FtsY homolog, chloropl... 68 9e-10 gb|PKA66406.1| Cell division protein FtsY like, chloroplastic [A... 68 1e-09 ref|XP_020699750.1| cell division protein FtsY homolog, chloropl... 68 1e-09 ref|XP_020114748.1| cell division protein FtsY homolog, chloropl... 68 1e-09 ref|XP_020573167.1| cell division protein FtsY homolog, chloropl... 68 1e-09 ref|XP_020114747.1| cell division protein FtsY homolog, chloropl... 68 1e-09 ref|XP_010934475.1| PREDICTED: cell division protein FtsY homolo... 67 2e-09 ref|XP_008775398.1| PREDICTED: cell division protein FtsY homolo... 67 2e-09 ref|XP_010934474.1| PREDICTED: cell division protein FtsY homolo... 67 2e-09 ref|XP_017973869.1| PREDICTED: cell division protein FtsY homolo... 64 2e-09 ref|XP_012083459.1| cell division protein FtsY homolog, chloropl... 67 2e-09 ref|XP_021669230.1| cell division protein FtsY homolog, chloropl... 67 2e-09 >gb|ONK59206.1| uncharacterized protein A4U43_C08F4070 [Asparagus officinalis] Length = 101 Score = 69.3 bits (168), Expect = 9e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKF+GVGEGVDDLQPFDAEAFVNAIFA Sbjct: 69 DELGIPVKFIGVGEGVDDLQPFDAEAFVNAIFA 101 >gb|PNX79520.1| cell division protein ftsy chloroplastic-like, partial [Trifolium pratense] Length = 101 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEGV+DLQPFDAEAFVNAIF Sbjct: 69 DELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 100 >ref|XP_020277218.1| LOW QUALITY PROTEIN: cell division protein FtsY homolog, chloroplastic [Asparagus officinalis] Length = 250 Score = 69.3 bits (168), Expect = 2e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKF+GVGEGVDDLQPFDAEAFVNAIFA Sbjct: 218 DELGIPVKFIGVGEGVDDLQPFDAEAFVNAIFA 250 >ref|XP_006386593.1| hypothetical protein POPTR_0002s15680g, partial [Populus trichocarpa] gb|PNT49867.1| hypothetical protein POPTR_002G155400v3, partial [Populus trichocarpa] Length = 198 Score = 67.0 bits (162), Expect = 5e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKFVGVGEGV+DLQPFDAEAFVNAIF+ Sbjct: 159 DELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 191 >ref|XP_011023398.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Populus euphratica] ref|XP_011023399.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Populus euphratica] Length = 93 Score = 64.3 bits (155), Expect = 6e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DE GIPVKFVGVGEGV+DLQPFDAEAFVNAIF+ Sbjct: 46 DEPGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 78 >ref|XP_013444937.1| signal recognition particle protein [Medicago truncatula] gb|KEH18962.1| signal recognition particle protein [Medicago truncatula] Length = 196 Score = 66.6 bits (161), Expect = 7e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEGV+DLQPFDAEAFVNAIF Sbjct: 164 DELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 195 >gb|OAY69661.1| Cell division protein FtsY, chloroplastic, partial [Ananas comosus] Length = 309 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF Sbjct: 277 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 308 >ref|XP_020114749.1| cell division protein FtsY homolog, chloroplastic isoform X3 [Ananas comosus] Length = 340 Score = 68.2 bits (165), Expect = 9e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF Sbjct: 308 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 339 >ref|XP_020699755.1| cell division protein FtsY homolog, chloroplastic isoform X2 [Dendrobium catenatum] Length = 352 Score = 68.2 bits (165), Expect = 9e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKF+GVGEGVDDLQPFDAEAFVNAIF+ Sbjct: 320 DELGIPVKFIGVGEGVDDLQPFDAEAFVNAIFS 352 >gb|PKA66406.1| Cell division protein FtsY like, chloroplastic [Apostasia shenzhenica] Length = 373 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF Sbjct: 341 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 372 >ref|XP_020699750.1| cell division protein FtsY homolog, chloroplastic isoform X1 [Dendrobium catenatum] gb|PKU63883.1| Cell division protein FtsY like, chloroplastic [Dendrobium catenatum] Length = 373 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKF+GVGEGVDDLQPFDAEAFVNAIF+ Sbjct: 341 DELGIPVKFIGVGEGVDDLQPFDAEAFVNAIFS 373 >ref|XP_020114748.1| cell division protein FtsY homolog, chloroplastic isoform X2 [Ananas comosus] gb|OAY83736.1| Cell division protein FtsY, chloroplastic [Ananas comosus] Length = 375 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF Sbjct: 343 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 374 >ref|XP_020573167.1| cell division protein FtsY homolog, chloroplastic isoform X1 [Phalaenopsis equestris] Length = 376 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKF+GVGEGVDDLQPFDAEAFVNAIF+ Sbjct: 341 DELGIPVKFIGVGEGVDDLQPFDAEAFVNAIFS 373 >ref|XP_020114747.1| cell division protein FtsY homolog, chloroplastic isoform X1 [Ananas comosus] Length = 408 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF Sbjct: 376 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 407 >ref|XP_010934475.1| PREDICTED: cell division protein FtsY homolog, chloroplastic isoform X2 [Elaeis guineensis] Length = 370 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKFVGVGEG+DDLQPFDAEAFVNAIF+ Sbjct: 338 DELGIPVKFVGVGEGLDDLQPFDAEAFVNAIFS 370 >ref|XP_008775398.1| PREDICTED: cell division protein FtsY homolog, chloroplastic [Phoenix dactylifera] Length = 371 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKFVGVGEG+DDLQPFDAEAFVNAIF+ Sbjct: 339 DELGIPVKFVGVGEGLDDLQPFDAEAFVNAIFS 371 >ref|XP_010934474.1| PREDICTED: cell division protein FtsY homolog, chloroplastic isoform X1 [Elaeis guineensis] Length = 375 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKFVGVGEG+DDLQPFDAEAFVNAIF+ Sbjct: 343 DELGIPVKFVGVGEGLDDLQPFDAEAFVNAIFS 375 >ref|XP_017973869.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Theobroma cacao] Length = 134 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIF 577 DELGIPVKFVGVGEG++DLQPFDAEAF NAIF Sbjct: 102 DELGIPVKFVGVGEGLEDLQPFDAEAFANAIF 133 >ref|XP_012083459.1| cell division protein FtsY homolog, chloroplastic isoform X3 [Jatropha curcas] Length = 355 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKFVGVGEGV+DLQPFDAEAFVNAIF+ Sbjct: 323 DELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 355 >ref|XP_021669230.1| cell division protein FtsY homolog, chloroplastic-like isoform X2 [Hevea brasiliensis] Length = 362 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 672 DELGIPVKFVGVGEGVDDLQPFDAEAFVNAIFA 574 DELGIPVKFVGVGEGV+DLQPFDAEAFVNAIF+ Sbjct: 330 DELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 362