BLASTX nr result
ID: Ophiopogon26_contig00009471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00009471 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA31169.1| hypothetical protein AQUCO_05200044v1 [Aquilegia ... 57 5e-07 >gb|PIA31169.1| hypothetical protein AQUCO_05200044v1 [Aquilegia coerulea] Length = 172 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/87 (36%), Positives = 52/87 (59%) Frame = -2 Query: 548 DISRDALAEVFGKEKRNRVRGVGSNTTRKELEHAAVANGLLNQMTTSSIAAIHTDVVKFA 369 D+ DALAEVFG EK+ R RG+ SN ++K+L++ A+ LL Q + SS + + T + Sbjct: 10 DMDTDALAEVFGPEKKTRTRGLTSNASKKQLKYVAIGKALL-QQSGSSNSNLETQM---- 64 Query: 368 SKFDTDLSDVKSSLMVLIQQSQGNTVT 288 + ++ + LM I Q+ GN+V+ Sbjct: 65 NGMQFQMNKMNDVLMAFINQASGNSVS 91