BLASTX nr result
ID: Ophiopogon26_contig00009464
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00009464 (1606 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251924.1| negative regulator of systemic acquired resi... 64 1e-08 ref|XP_020251925.1| negative regulator of systemic acquired resi... 64 1e-08 ref|XP_020251926.1| negative regulator of systemic acquired resi... 64 1e-08 >ref|XP_020251924.1| negative regulator of systemic acquired resistance SNI1 isoform X1 [Asparagus officinalis] Length = 455 Score = 64.3 bits (155), Expect(2) = 1e-08 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 1457 FKILSGNNSLELAMASYQLLIELDKHYPRIYPKRPNN 1567 F+ILSG++SLELAMASYQLLI+LDKHYPRIY K P+N Sbjct: 48 FQILSGSDSLELAMASYQLLIDLDKHYPRIYLKSPDN 84 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 1386 LPKELLFLEAARAASQLSHSPSAPS 1460 L +L FLEA R++S P+APS Sbjct: 16 LDDKLSFLEAVRSSSLAEEPPTAPS 40 >ref|XP_020251925.1| negative regulator of systemic acquired resistance SNI1 isoform X2 [Asparagus officinalis] gb|ONK81566.1| uncharacterized protein A4U43_C01F30610 [Asparagus officinalis] Length = 454 Score = 64.3 bits (155), Expect(2) = 1e-08 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 1457 FKILSGNNSLELAMASYQLLIELDKHYPRIYPKRPNN 1567 F+ILSG++SLELAMASYQLLI+LDKHYPRIY K P+N Sbjct: 48 FQILSGSDSLELAMASYQLLIDLDKHYPRIYLKSPDN 84 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 1386 LPKELLFLEAARAASQLSHSPSAPS 1460 L +L FLEA R++S P+APS Sbjct: 16 LDDKLSFLEAVRSSSLAEEPPTAPS 40 >ref|XP_020251926.1| negative regulator of systemic acquired resistance SNI1 isoform X3 [Asparagus officinalis] Length = 395 Score = 64.3 bits (155), Expect(2) = 1e-08 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 1457 FKILSGNNSLELAMASYQLLIELDKHYPRIYPKRPNN 1567 F+ILSG++SLELAMASYQLLI+LDKHYPRIY K P+N Sbjct: 48 FQILSGSDSLELAMASYQLLIDLDKHYPRIYLKSPDN 84 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 1386 LPKELLFLEAARAASQLSHSPSAPS 1460 L +L FLEA R++S P+APS Sbjct: 16 LDDKLSFLEAVRSSSLAEEPPTAPS 40