BLASTX nr result
ID: Ophiopogon26_contig00009385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00009385 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus... 56 2e-06 >gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus officinalis] Length = 229 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/81 (33%), Positives = 48/81 (59%) Frame = +1 Query: 97 VITMLLQESSILDCPLLADCKLLL*SMQAFRIARIYKEGNTVADFMANLGGIIEALTLWE 276 V+ +L +E D P+L +CK ++ S++ ++I+ I++E N D +AN+G + LWE Sbjct: 148 VLDLLSKEPYHTDSPILVNCKSIISSIEEYKISHIFREVNASGDLLANMGCGTTSSILWE 207 Query: 277 GNFPEELVYLVMRDVSGAYMR 339 P L+ V RD+ G ++R Sbjct: 208 FEIPGTLLASVERDMRGPFVR 228