BLASTX nr result
ID: Ophiopogon26_contig00008697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00008697 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008809853.2| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_008809853.2| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 [Phoenix dactylifera] Length = 747 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -1 Query: 489 GKWEEASNIREQMRNKGVVKKPGCSWIESENIST 388 GKWEEAS++R+QM+ GV KKPGCSWIE ++T Sbjct: 712 GKWEEASSVRDQMQKNGVAKKPGCSWIEDIQLTT 745