BLASTX nr result
ID: Ophiopogon26_contig00008568
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00008568 (942 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACL53984.1| unknown [Zea mays] 90 3e-17 gb|ONK73776.1| uncharacterized protein A4U43_C04F35250 [Asparagu... 90 2e-16 ref|XP_016451762.1| PREDICTED: putative glycerol-3-phosphate tra... 91 2e-16 dbj|BAT03894.1| Os08g0156600, partial [Oryza sativa Japonica Group] 89 2e-16 ref|NP_001136743.1| uncharacterized protein LOC100216884 [Zea ma... 90 2e-16 gb|PAN33689.1| hypothetical protein PAHAL_F01027 [Panicum hallii... 90 2e-16 ref|XP_004972807.1| putative glycerol-3-phosphate transporter 1 ... 90 2e-16 ref|XP_020263729.1| LOW QUALITY PROTEIN: putative glycerol-3-pho... 90 2e-16 ref|XP_002443886.1| putative glycerol-3-phosphate transporter 1 ... 90 2e-16 ref|XP_008676670.1| uncharacterized protein LOC100216884 isoform... 90 2e-16 ref|NP_001147465.1| glycerol 3-phosphate permease [Zea mays] >gi... 90 2e-16 ref|XP_020400625.1| glycerol 3-phosphate permease isoform X1 [Ze... 90 2e-16 gb|OEL19617.1| putative glycerol-3-phosphate transporter 1 [Dich... 90 2e-16 ref|XP_020157841.1| putative glycerol-3-phosphate transporter 1 ... 90 3e-16 dbj|BAK01081.1| predicted protein [Hordeum vulgare subsp. vulgare] 90 3e-16 ref|XP_003573477.1| PREDICTED: putative glycerol-3-phosphate tra... 90 3e-16 gb|ONK59015.1| uncharacterized protein A4U43_C08F2090 [Asparagus... 89 4e-16 gb|EMS66165.1| Putative glycerol-3-phosphate transporter 1 [Trit... 90 4e-16 ref|XP_022887105.1| putative glycerol-3-phosphate transporter 1 ... 89 4e-16 ref|XP_020244234.1| LOW QUALITY PROTEIN: putative glycerol-3-pho... 89 4e-16 >gb|ACL53984.1| unknown [Zea mays] Length = 263 Score = 90.1 bits (222), Expect = 3e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 36 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 75 >gb|ONK73776.1| uncharacterized protein A4U43_C04F35250 [Asparagus officinalis] Length = 409 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 293 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 332 >ref|XP_016451762.1| PREDICTED: putative glycerol-3-phosphate transporter 1 isoform X1 [Nicotiana tabacum] ref|XP_016451763.1| PREDICTED: putative glycerol-3-phosphate transporter 1 isoform X1 [Nicotiana tabacum] ref|XP_016451764.1| PREDICTED: putative glycerol-3-phosphate transporter 1 isoform X1 [Nicotiana tabacum] Length = 506 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHTG 123 VGF+EAWRIPGVAPFALCLFF+KLVAYTFLYWLPFYISHTG Sbjct: 282 VGFIEAWRIPGVAPFALCLFFAKLVAYTFLYWLPFYISHTG 322 >dbj|BAT03894.1| Os08g0156600, partial [Oryza sativa Japonica Group] Length = 326 Score = 89.0 bits (219), Expect = 2e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAW+IPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 100 VGFLEAWKIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 139 >ref|NP_001136743.1| uncharacterized protein LOC100216884 [Zea mays] gb|ACF82521.1| unknown [Zea mays] Length = 495 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 269 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 308 >gb|PAN33689.1| hypothetical protein PAHAL_F01027 [Panicum hallii] gb|PAN33690.1| hypothetical protein PAHAL_F01027 [Panicum hallii] Length = 499 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 273 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 312 >ref|XP_004972807.1| putative glycerol-3-phosphate transporter 1 [Setaria italica] ref|XP_012702502.1| putative glycerol-3-phosphate transporter 1 [Setaria italica] gb|KQL00747.1| hypothetical protein SETIT_013609mg [Setaria italica] Length = 499 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 273 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 312 >ref|XP_020263729.1| LOW QUALITY PROTEIN: putative glycerol-3-phosphate transporter 1 [Asparagus officinalis] Length = 500 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 293 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 332 >ref|XP_002443886.1| putative glycerol-3-phosphate transporter 1 [Sorghum bicolor] gb|EES13381.1| hypothetical protein SORBI_3007G045500 [Sorghum bicolor] Length = 501 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 275 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 314 >ref|XP_008676670.1| uncharacterized protein LOC100216884 isoform X1 [Zea mays] gb|AQK50765.1| Putative glycerol-3-phosphate transporter 1 [Zea mays] Length = 503 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 277 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 316 >ref|NP_001147465.1| glycerol 3-phosphate permease [Zea mays] gb|ACG27627.1| glycerol 3-phosphate permease [Zea mays] Length = 507 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 280 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 319 >ref|XP_020400625.1| glycerol 3-phosphate permease isoform X1 [Zea mays] gb|AQK41516.1| Putative glycerol-3-phosphate transporter 1 [Zea mays] gb|AQK41517.1| Putative glycerol-3-phosphate transporter 1 [Zea mays] Length = 507 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 280 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 319 >gb|OEL19617.1| putative glycerol-3-phosphate transporter 1 [Dichanthelium oligosanthes] Length = 526 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 273 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 312 >ref|XP_020157841.1| putative glycerol-3-phosphate transporter 1 [Aegilops tauschii subsp. tauschii] ref|XP_020157842.1| putative glycerol-3-phosphate transporter 1 [Aegilops tauschii subsp. tauschii] Length = 498 Score = 89.7 bits (221), Expect = 3e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 +GFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 272 IGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 311 >dbj|BAK01081.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 498 Score = 89.7 bits (221), Expect = 3e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 +GFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 272 IGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 311 >ref|XP_003573477.1| PREDICTED: putative glycerol-3-phosphate transporter 1 [Brachypodium distachyon] gb|KQJ95342.1| hypothetical protein BRADI_3g16640v3 [Brachypodium distachyon] Length = 499 Score = 89.7 bits (221), Expect = 3e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 +GFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 273 IGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 312 >gb|ONK59015.1| uncharacterized protein A4U43_C08F2090 [Asparagus officinalis] Length = 466 Score = 89.4 bits (220), Expect = 4e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGF+EAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 288 VGFIEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 327 >gb|EMS66165.1| Putative glycerol-3-phosphate transporter 1 [Triticum urartu] Length = 624 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 +GFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 398 IGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 437 >ref|XP_022887105.1| putative glycerol-3-phosphate transporter 1 [Olea europaea var. sylvestris] Length = 413 Score = 89.0 bits (219), Expect = 4e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGFLEAWRIPGVAPFALCLFF+KLVAYTFLYWLPFYISHT Sbjct: 201 VGFLEAWRIPGVAPFALCLFFAKLVAYTFLYWLPFYISHT 240 >ref|XP_020244234.1| LOW QUALITY PROTEIN: putative glycerol-3-phosphate transporter 1 [Asparagus officinalis] Length = 508 Score = 89.4 bits (220), Expect = 4e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 VGFLEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 120 VGF+EAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT Sbjct: 288 VGFIEAWRIPGVAPFALCLFFSKLVAYTFLYWLPFYISHT 327