BLASTX nr result
ID: Ophiopogon26_contig00007884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00007884 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020263929.1| beta-glucosidase 1-like [Asparagus officinal... 124 2e-30 gb|KYP65520.1| Beta-glucosidase 44 [Cajanus cajan] 111 3e-28 gb|ABC55718.1| beta-mannosidase 1 [Oncidium hybrid cultivar] 117 3e-28 gb|ABC55716.1| beta-mannosidase 3 [Oncidium hybrid cultivar] 117 3e-28 ref|XP_020672326.1| beta-glucosidase 1-like [Dendrobium catenatu... 117 7e-28 gb|ONK66357.1| uncharacterized protein A4U43_C06F6890 [Asparagus... 115 7e-28 ref|XP_002533126.1| PREDICTED: beta-glucosidase 44 [Ricinus comm... 116 1e-27 ref|XP_020269563.1| beta-glucosidase 1-like [Asparagus officinalis] 115 1e-27 ref|XP_020581167.1| beta-glucosidase 1-like [Phalaenopsis equest... 115 3e-27 ref|XP_010922562.1| PREDICTED: beta-glucosidase 1-like [Elaeis g... 115 3e-27 ref|XP_023925668.1| beta-glucosidase 1-like, partial [Quercus su... 107 4e-27 gb|ABC55717.1| beta-mannosidase 2 [Oncidium hybrid cultivar] 114 6e-27 ref|XP_020271226.1| beta-glucosidase 1-like [Asparagus officinal... 114 9e-27 gb|PPD90195.1| hypothetical protein GOBAR_DD12858 [Gossypium bar... 106 1e-26 gb|ERM98129.1| hypothetical protein AMTR_s00095p00053410 [Ambore... 104 2e-26 ref|XP_023925685.1| beta-glucosidase 44-like [Quercus suber] 107 2e-26 ref|XP_023924185.1| beta-glucosidase 44-like, partial [Quercus s... 107 3e-26 gb|ARU79071.1| beta-glucosidase 3 GH1 family [Camellia sinensis] 112 3e-26 gb|OVA18774.1| Glycoside hydrolase [Macleaya cordata] 112 4e-26 ref|XP_008792825.1| PREDICTED: beta-glucosidase 1-like [Phoenix ... 112 5e-26 >ref|XP_020263929.1| beta-glucosidase 1-like [Asparagus officinalis] gb|ONK81454.1| uncharacterized protein A4U43_C01F29260 [Asparagus officinalis] Length = 481 Score = 124 bits (310), Expect = 2e-30 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK+ Sbjct: 425 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKH 481 >gb|KYP65520.1| Beta-glucosidase 44 [Cajanus cajan] Length = 178 Score = 111 bits (278), Expect = 3e-28 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 DGANV+GYFAWSLLDNFEW+ GYTSRFG+VYVDFKTLKRYPKMSAYWFR ++ +KK+ Sbjct: 122 DGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFRQLIAKKKH 178 >gb|ABC55718.1| beta-mannosidase 1 [Oncidium hybrid cultivar] Length = 491 Score = 117 bits (294), Expect = 3e-28 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGA VIGYFAWSLLDNFEWKSGYTSRFG+VYVDFKTLKRYPKMSAYWFRD+LQ+KK Sbjct: 436 DGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQKKK 491 >gb|ABC55716.1| beta-mannosidase 3 [Oncidium hybrid cultivar] Length = 491 Score = 117 bits (294), Expect = 3e-28 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGA VIGYFAWSLLDNFEWKSGYTSRFG+VYVDFKTLKRYPKMSAYWFRD+LQ+KK Sbjct: 436 DGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFKTLKRYPKMSAYWFRDVLQKKK 491 >ref|XP_020672326.1| beta-glucosidase 1-like [Dendrobium catenatum] gb|PKU68257.1| Beta-glucosidase 1 [Dendrobium catenatum] Length = 514 Score = 117 bits (292), Expect = 7e-28 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGA VIGYFAWSLLDNFEWKSGYTSRFG+VYVDFKTL+RYPKMSAYWFRD+LQ+KK Sbjct: 459 DGATVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFKTLRRYPKMSAYWFRDLLQKKK 514 >gb|ONK66357.1| uncharacterized protein A4U43_C06F6890 [Asparagus officinalis] Length = 366 Score = 115 bits (287), Expect = 7e-28 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGANVIGYFAWSLLDNFEW GYTSRFGLVYVDF+ LKRYPKMSAYWFRDML+RKK Sbjct: 309 DGANVIGYFAWSLLDNFEWTKGYTSRFGLVYVDFENLKRYPKMSAYWFRDMLERKK 364 >ref|XP_002533126.1| PREDICTED: beta-glucosidase 44 [Ricinus communis] gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis] Length = 517 Score = 116 bits (291), Expect = 1e-27 Identities = 50/57 (87%), Positives = 55/57 (96%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 DGANV+GYFAWSL+DNFEW+SGYTSRFG+VYVDF TLKRYPKMSAYWF+ MLQRKKN Sbjct: 461 DGANVVGYFAWSLVDNFEWRSGYTSRFGIVYVDFTTLKRYPKMSAYWFKQMLQRKKN 517 >ref|XP_020269563.1| beta-glucosidase 1-like [Asparagus officinalis] Length = 406 Score = 115 bits (287), Expect = 1e-27 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGANVIGYFAWSLLDNFEW GYTSRFGLVYVDF+ LKRYPKMSAYWFRDML+RKK Sbjct: 349 DGANVIGYFAWSLLDNFEWTKGYTSRFGLVYVDFENLKRYPKMSAYWFRDMLERKK 404 >ref|XP_020581167.1| beta-glucosidase 1-like [Phalaenopsis equestris] Length = 515 Score = 115 bits (288), Expect = 3e-27 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGA VIGYFAWSLLDNFEWK GYT+RFG+VYVDFKTLKRYPKMSAYWFRD+LQRKK Sbjct: 460 DGATVIGYFAWSLLDNFEWKLGYTARFGIVYVDFKTLKRYPKMSAYWFRDVLQRKK 515 >ref|XP_010922562.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis] Length = 509 Score = 115 bits (287), Expect = 3e-27 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRK 266 DGANVIGYFAWSLLDNFEWKSGYTSRFG+VYVDF LKRYPKMSAYWFRDML+RK Sbjct: 454 DGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDFTNLKRYPKMSAYWFRDMLKRK 508 >ref|XP_023925668.1| beta-glucosidase 1-like, partial [Quercus suber] Length = 138 Score = 107 bits (267), Expect = 4e-27 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 +GANVIGYFAWSLLDNFEW+SGYTSRFG+VY+D+ LKRYPKMSAYWF+ +LQR K+ Sbjct: 82 EGANVIGYFAWSLLDNFEWRSGYTSRFGIVYIDYTNLKRYPKMSAYWFKRLLQRNKH 138 >gb|ABC55717.1| beta-mannosidase 2 [Oncidium hybrid cultivar] Length = 501 Score = 114 bits (285), Expect = 6e-27 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGA VIGYFAWSLLDNFEWK GYTSRFG+VYVDFKTLKRYPKMSAYWF+D+LQ+KK Sbjct: 446 DGATVIGYFAWSLLDNFEWKLGYTSRFGIVYVDFKTLKRYPKMSAYWFKDVLQKKK 501 >ref|XP_020271226.1| beta-glucosidase 1-like [Asparagus officinalis] gb|ONK66358.1| uncharacterized protein A4U43_C06F6900 [Asparagus officinalis] Length = 510 Score = 114 bits (284), Expect = 9e-27 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGANVI YFAWSLLDNFEWKSGYTSRFGLVYVDFK+LKR+PKMSAYWFR ML+RKK Sbjct: 453 DGANVIAYFAWSLLDNFEWKSGYTSRFGLVYVDFKSLKRHPKMSAYWFRHMLERKK 508 >gb|PPD90195.1| hypothetical protein GOBAR_DD12858 [Gossypium barbadense] Length = 143 Score = 106 bits (265), Expect = 1e-26 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 +GANVIGYFAWSLLDNFEW+ GYTSRFG+VYVD+ TLKRYPKM+AYWF+ +L RKK+ Sbjct: 87 NGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSTLKRYPKMTAYWFKQLLTRKKH 143 >gb|ERM98129.1| hypothetical protein AMTR_s00095p00053410 [Amborella trichopoda] Length = 103 Score = 104 bits (260), Expect = 2e-26 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 D NV+GYFAWSL DNFEW+SGYTSRFGLVYVD++TLKRYPKMSA WFR++LQ K N Sbjct: 47 DRVNVVGYFAWSLFDNFEWRSGYTSRFGLVYVDYQTLKRYPKMSASWFRNLLQSKSN 103 >ref|XP_023925685.1| beta-glucosidase 44-like [Quercus suber] Length = 196 Score = 107 bits (267), Expect = 2e-26 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 +GANVIGYFAWSLLDNFEW+SGYTSRFG+VY+D+ LKRYPKMSAYWF+ +LQR K+ Sbjct: 140 EGANVIGYFAWSLLDNFEWRSGYTSRFGIVYIDYTNLKRYPKMSAYWFKRLLQRNKH 196 >ref|XP_023924185.1| beta-glucosidase 44-like, partial [Quercus suber] Length = 208 Score = 107 bits (267), Expect = 3e-26 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 +GANVIGYFAWSLLDNFEW+SGYTSRFG+VY+D+ LKRYPKMSAYWF+ +LQR K+ Sbjct: 152 EGANVIGYFAWSLLDNFEWRSGYTSRFGIVYIDYTNLKRYPKMSAYWFKRLLQRNKH 208 >gb|ARU79071.1| beta-glucosidase 3 GH1 family [Camellia sinensis] Length = 518 Score = 112 bits (280), Expect = 3e-26 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKKN 260 DGANV+GYFAWSLLDNFEW+ GYTSRFG+VYVDFKTLKRYPKMSAYWFR +L+R K+ Sbjct: 462 DGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFRQLLRRNKH 518 >gb|OVA18774.1| Glycoside hydrolase [Macleaya cordata] Length = 536 Score = 112 bits (280), Expect = 4e-26 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGANV GYFAWSLLDNFEW+SGYTSRFG+VYVD+K LKRYPKMSAYWF++ML+RKK Sbjct: 480 DGANVTGYFAWSLLDNFEWRSGYTSRFGIVYVDYKNLKRYPKMSAYWFKEMLRRKK 535 >ref|XP_008792825.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera] Length = 512 Score = 112 bits (279), Expect = 5e-26 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -1 Query: 430 DGANVIGYFAWSLLDNFEWKSGYTSRFGLVYVDFKTLKRYPKMSAYWFRDMLQRKK 263 DGANVIGYFAWSLLDNFEWK GYTSRFG+VYVD++TLKRYPKMSAYWF +ML+RKK Sbjct: 457 DGANVIGYFAWSLLDNFEWKLGYTSRFGVVYVDYRTLKRYPKMSAYWFGEMLRRKK 512