BLASTX nr result
ID: Ophiopogon26_contig00007660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00007660 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK66567.1| uncharacterized protein A4U43_C06F9590 [Asparagus... 60 6e-10 >gb|ONK66567.1| uncharacterized protein A4U43_C06F9590 [Asparagus officinalis] Length = 336 Score = 60.5 bits (145), Expect(2) = 6e-10 Identities = 33/60 (55%), Positives = 39/60 (65%) Frame = -1 Query: 435 ATDAVEKKTSTTTSAPKDPERQLSXXXXXXXXXXXLDAILAELGLSGQEQPNEGNKSEEQ 256 A++ + K TTSAPK+ ERQLS LDA+LAELG+S QEQ NEG KSEEQ Sbjct: 170 ASEPTKNKPLPTTSAPKENERQLSKKELKKKGLEELDALLAELGISSQEQSNEGKKSEEQ 229 Score = 30.8 bits (68), Expect(2) = 6e-10 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 7/40 (17%) Frame = -2 Query: 212 QELQQVNGGHASTDTE-------NASRAKDAEEDASATDV 114 ++ QQ NGG+ + DTE + S AKD E++ S DV Sbjct: 268 EQQQQPNGGYTNKDTEKDNYTEKDVSGAKDTEDNGSTADV 307