BLASTX nr result
ID: Ophiopogon26_contig00007644
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00007644 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257222.1| probable xyloglucan endotransglucosylase/hyd... 78 4e-14 ref|XP_020704239.1| probable xyloglucan endotransglucosylase/hyd... 57 1e-06 >ref|XP_020257222.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 [Asparagus officinalis] gb|ONK75361.1| uncharacterized protein A4U43_C03F16030 [Asparagus officinalis] Length = 327 Score = 78.2 bits (191), Expect = 4e-14 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 472 YITYSYCYDRERYPTPTPECSIDAREAKQVYRSGGERLMD 353 Y+TYSYCYDRERYPT TPECS+D REAK VYRS GER MD Sbjct: 272 YVTYSYCYDRERYPTRTPECSVDLREAKHVYRSSGERFMD 311 >ref|XP_020704239.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 [Dendrobium catenatum] gb|PKU79888.1| putative xyloglucan endotransglucosylase/hydrolase protein 28 [Dendrobium catenatum] Length = 340 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -2 Query: 472 YITYSYCYDRERYPTPTPECSIDAREAKQVYRSGGER 362 ++TYSYCYD +RYPTP PECS+D REA+Q +G R Sbjct: 281 HLTYSYCYDGDRYPTPPPECSVDPREAEQFEGAGSGR 317