BLASTX nr result
ID: Ophiopogon26_contig00007516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00007516 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274274.1| beta-glucosidase 11-like [Asparagus officina... 57 9e-07 >ref|XP_020274274.1| beta-glucosidase 11-like [Asparagus officinalis] ref|XP_020274275.1| beta-glucosidase 11-like [Asparagus officinalis] gb|ONK62937.1| uncharacterized protein A4U43_C07F9670 [Asparagus officinalis] Length = 504 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -2 Query: 361 ERKRYPKLSARWYSNFLKRKGNDIYMSNSSPYETQV 254 ERKRYPK SARWYS+FLKR+GN IY SS Y Q+ Sbjct: 468 ERKRYPKHSARWYSHFLKRRGNSIYTDKSSSYVPQI 503