BLASTX nr result
ID: Ophiopogon26_contig00006966
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00006966 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS55349.1| Monothiol glutaredoxin-S7, chloroplastic [Triticu... 99 3e-24 ref|XP_019161502.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 101 3e-24 ref|XP_019052478.1| PREDICTED: monothiol glutaredoxin-S14, chlor... 98 4e-24 ref|XP_010111052.1| uncharacterized protein LOC21398218 [Morus n... 100 5e-24 ref|XP_006652025.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 99 6e-24 ref|XP_016484933.1| PREDICTED: uncharacterized monothiol glutare... 100 8e-24 ref|XP_009779743.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 100 8e-24 ref|XP_009624102.1| PREDICTED: uncharacterized protein LOC104115... 100 8e-24 ref|XP_019230289.1| PREDICTED: uncharacterized protein LOC109211... 100 9e-24 gb|PIN24235.1| Glutaredoxin [Handroanthus impetiginosus] 100 1e-23 gb|OAY80447.1| Monothiol glutaredoxin-S14, chloroplastic [Ananas... 100 1e-23 gb|PHT90856.1| Monothiol glutaredoxin-S14, chloroplastic [Capsic... 100 1e-23 ref|XP_004492822.1| PREDICTED: monothiol glutaredoxin-S14, chlor... 100 1e-23 gb|PHU26632.1| Monothiol glutaredoxin-S14, chloroplastic [Capsic... 100 1e-23 ref|XP_016560321.1| PREDICTED: uncharacterized monothiol glutare... 100 1e-23 ref|XP_015570965.1| PREDICTED: uncharacterized monothiol glutare... 99 1e-23 ref|XP_020189708.1| monothiol glutaredoxin-S7, chloroplastic-lik... 99 2e-23 ref|XP_021611157.1| uncharacterized protein LOC110614018 [Maniho... 99 2e-23 ref|XP_006844761.2| monothiol glutaredoxin-S7, chloroplastic [Am... 99 2e-23 ref|XP_004152834.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 99 2e-23 >gb|EMS55349.1| Monothiol glutaredoxin-S7, chloroplastic [Triticum urartu] Length = 103 Score = 99.0 bits (245), Expect = 3e-24 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLKDYSSWPTFPQLYIDGEFFGGCDIT+EAY+ GELQE LEK MCS Sbjct: 55 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITLEAYKSGELQETLEKAMCS 103 >ref|XP_019161502.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Ipomoea nil] Length = 184 Score = 101 bits (251), Expect = 3e-24 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQE+LEKTMCS Sbjct: 136 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQEVLEKTMCS 184 >ref|XP_019052478.1| PREDICTED: monothiol glutaredoxin-S14, chloroplastic [Nelumbo nucifera] Length = 86 Score = 98.2 bits (243), Expect = 4e-24 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YS+WPTFPQLYIDGEFFGGCDITVEAY+ G+LQELLEK MCS Sbjct: 38 LRQGLKEYSNWPTFPQLYIDGEFFGGCDITVEAYKNGQLQELLEKVMCS 86 >ref|XP_010111052.1| uncharacterized protein LOC21398218 [Morus notabilis] gb|EXC29914.1| Monothiol glutaredoxin-S7 [Morus notabilis] Length = 184 Score = 100 bits (250), Expect = 5e-24 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITV+AYE GELQELLEK MCS Sbjct: 136 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVDAYESGELQELLEKAMCS 184 >ref|XP_006652025.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic, partial [Oryza brachyantha] Length = 115 Score = 98.6 bits (244), Expect = 6e-24 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQE LEK MCS Sbjct: 67 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKNGELQETLEKAMCS 115 >ref|XP_016484933.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Nicotiana tabacum] Length = 175 Score = 100 bits (248), Expect = 8e-24 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQELLE+T+CS Sbjct: 127 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQELLERTLCS 175 >ref|XP_009779743.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Nicotiana sylvestris] ref|XP_016472352.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Nicotiana tabacum] Length = 175 Score = 100 bits (248), Expect = 8e-24 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQELLE+T+CS Sbjct: 127 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQELLERTLCS 175 >ref|XP_009624102.1| PREDICTED: uncharacterized protein LOC104115221 [Nicotiana tomentosiformis] Length = 175 Score = 100 bits (248), Expect = 8e-24 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQELLE+T+CS Sbjct: 127 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQELLERTLCS 175 >ref|XP_019230289.1| PREDICTED: uncharacterized protein LOC109211234 [Nicotiana attenuata] Length = 180 Score = 100 bits (248), Expect = 9e-24 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQELLE+T+CS Sbjct: 132 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQELLERTLCS 180 >gb|PIN24235.1| Glutaredoxin [Handroanthus impetiginosus] Length = 172 Score = 99.8 bits (247), Expect = 1e-23 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQE+LEK MCS Sbjct: 124 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQEILEKAMCS 172 >gb|OAY80447.1| Monothiol glutaredoxin-S14, chloroplastic [Ananas comosus] Length = 204 Score = 100 bits (249), Expect = 1e-23 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YS+WPTFPQLYIDGEFFGGCDITVEAY+ GELQE+LEKTMCS Sbjct: 156 LRQGLKEYSNWPTFPQLYIDGEFFGGCDITVEAYKSGELQEILEKTMCS 204 >gb|PHT90856.1| Monothiol glutaredoxin-S14, chloroplastic [Capsicum annuum] Length = 176 Score = 99.8 bits (247), Expect = 1e-23 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLY+DGEFFGGCDITVEAY+ GELQELLE+T+CS Sbjct: 128 LRQGLKEYSSWPTFPQLYVDGEFFGGCDITVEAYKSGELQELLERTLCS 176 >ref|XP_004492822.1| PREDICTED: monothiol glutaredoxin-S14, chloroplastic [Cicer arietinum] Length = 178 Score = 99.8 bits (247), Expect = 1e-23 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLKDYS+WPTFPQLYIDGEFFGGCDITVEAY+ GELQEL+EK MCS Sbjct: 130 LRQGLKDYSNWPTFPQLYIDGEFFGGCDITVEAYKNGELQELVEKAMCS 178 >gb|PHU26632.1| Monothiol glutaredoxin-S14, chloroplastic [Capsicum chinense] Length = 181 Score = 99.8 bits (247), Expect = 1e-23 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLY+DGEFFGGCDITVEAY+ GELQELLE+T+CS Sbjct: 133 LRQGLKEYSSWPTFPQLYVDGEFFGGCDITVEAYKSGELQELLERTLCS 181 >ref|XP_016560321.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Capsicum annuum] Length = 182 Score = 99.8 bits (247), Expect = 1e-23 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLY+DGEFFGGCDITVEAY+ GELQELLE+T+CS Sbjct: 134 LRQGLKEYSSWPTFPQLYVDGEFFGGCDITVEAYKSGELQELLERTLCS 182 >ref|XP_015570965.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Ricinus communis] ref|XP_015570966.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Ricinus communis] Length = 169 Score = 99.4 bits (246), Expect = 1e-23 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQELLE+ MCS Sbjct: 121 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQELLERAMCS 169 >ref|XP_020189708.1| monothiol glutaredoxin-S7, chloroplastic-like [Aegilops tauschii subsp. tauschii] Length = 163 Score = 99.0 bits (245), Expect = 2e-23 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLKDYSSWPTFPQLYIDGEFFGGCDIT+EAY+ GELQE LEK MCS Sbjct: 115 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITLEAYKSGELQETLEKAMCS 163 >ref|XP_021611157.1| uncharacterized protein LOC110614018 [Manihot esculenta] gb|OAY52588.1| hypothetical protein MANES_04G095400 [Manihot esculenta] Length = 177 Score = 99.4 bits (246), Expect = 2e-23 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQELLE+ MCS Sbjct: 129 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQELLERAMCS 177 >ref|XP_006844761.2| monothiol glutaredoxin-S7, chloroplastic [Amborella trichopoda] Length = 178 Score = 99.4 bits (246), Expect = 2e-23 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YS+WPTFPQLYIDGEFFGGCDITVEAY+ GELQELLEK MCS Sbjct: 130 LRQGLKEYSNWPTFPQLYIDGEFFGGCDITVEAYKNGELQELLEKAMCS 178 >ref|XP_004152834.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Cucumis sativus] gb|KGN61246.1| hypothetical protein Csa_2G074080 [Cucumis sativus] Length = 178 Score = 99.4 bits (246), Expect = 2e-23 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 418 LRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYEKGELQELLEKTMCS 272 LRQGLK+YSSWPTFPQLYIDGEFFGGCDITVEAY+ GELQE+LEK MCS Sbjct: 130 LRQGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQEVLEKAMCS 178