BLASTX nr result
ID: Ophiopogon26_contig00006692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00006692 (669 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247458.1| histone H1oo-like [Asparagus officinalis] 68 1e-09 >ref|XP_020247458.1| histone H1oo-like [Asparagus officinalis] Length = 442 Score = 68.2 bits (165), Expect = 1e-09 Identities = 45/113 (39%), Positives = 64/113 (56%), Gaps = 6/113 (5%) Frame = +1 Query: 115 AISASGEKRKRGRPPKNSYLSIP------LASGDXXXXXXXXXXSLTPKLDSALPSGEKR 276 A ++SGEKRKRGRP K+ + + LASG+ S + +L +A SGEKR Sbjct: 330 ASASSGEKRKRGRPSKSDSIPVKPKISTVLASGEKRKRGRPKKESASAQLAAASGSGEKR 389 Query: 277 KRGRPKKVSAAMVNSGENAVMLPLAQNTAGEVSAAVDSGSDNLPAMLVALSSE 435 KRGRPKKV A+++ ++V A + A + A D SD++PA + A SE Sbjct: 390 KRGRPKKVPVAVLDGASDSVP---AGDGASDSVLAGDGASDSVPAKVEAPMSE 439