BLASTX nr result
ID: Ophiopogon26_contig00006429
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00006429 (645 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244029.1| pentatricopeptide repeat-containing protein ... 58 3e-06 >ref|XP_020244029.1| pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Asparagus officinalis] ref|XP_020244030.1| pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Asparagus officinalis] gb|ONK59991.1| uncharacterized protein A4U43_C08F13060 [Asparagus officinalis] Length = 471 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/49 (61%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KKSCYREALQVLDEMLNQSISPDSTLWEALVVGRRSSQLRT-VDLDMII 144 +K EAL+VL+EML++SI PD+TLWEAL+VG RS+QLRT VD ++I+ Sbjct: 421 RKDRLSEALRVLNEMLDRSIFPDATLWEALLVGYRSNQLRTPVDFNIIL 469