BLASTX nr result
ID: Ophiopogon26_contig00005838
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00005838 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC77392.1| hypothetical protein OsI_16148 [Oryza sativa Indi... 53 5e-06 ref|XP_009409905.1| PREDICTED: somatic embryogenesis receptor ki... 56 7e-06 ref|XP_018684873.1| PREDICTED: somatic embryogenesis receptor ki... 56 7e-06 gb|OVA06627.1| Protein kinase domain [Macleaya cordata] 56 7e-06 ref|XP_009409904.1| PREDICTED: somatic embryogenesis receptor ki... 56 7e-06 ref|XP_009409903.1| PREDICTED: somatic embryogenesis receptor ki... 56 7e-06 >gb|EEC77392.1| hypothetical protein OsI_16148 [Oryza sativa Indica Group] Length = 92 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +2 Query: 11 VRQEMEMAPRHSEWILDSTDNLHAFELSGPR 103 VRQE E+APRH++WI+DST NL A ELSGPR Sbjct: 62 VRQEAELAPRHNDWIVDSTYNLRAMELSGPR 92 >ref|XP_009409905.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X4 [Musa acuminata subsp. malaccensis] Length = 581 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 11 VRQEMEMAP-RHSEWILDSTDNLHAFELSGPR 103 VRQE EMAP R+SEWI+DSTDNLHA ELSGPR Sbjct: 550 VRQEFEMAPHRNSEWIIDSTDNLHAVELSGPR 581 >ref|XP_018684873.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X3 [Musa acuminata subsp. malaccensis] Length = 599 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 11 VRQEMEMAP-RHSEWILDSTDNLHAFELSGPR 103 VRQE EMAP R+SEWI+DSTDNLHA ELSGPR Sbjct: 568 VRQEFEMAPHRNSEWIIDSTDNLHAVELSGPR 599 >gb|OVA06627.1| Protein kinase domain [Macleaya cordata] Length = 600 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/32 (84%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = +2 Query: 11 VRQEMEMAP-RHSEWILDSTDNLHAFELSGPR 103 VRQE+E+AP R+SEWILDSTDNLHA ELSGPR Sbjct: 569 VRQEVELAPHRNSEWILDSTDNLHAVELSGPR 600 >ref|XP_009409904.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 628 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 11 VRQEMEMAP-RHSEWILDSTDNLHAFELSGPR 103 VRQE EMAP R+SEWI+DSTDNLHA ELSGPR Sbjct: 597 VRQEFEMAPHRNSEWIIDSTDNLHAVELSGPR 628 >ref|XP_009409903.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X1 [Musa acuminata subsp. malaccensis] Length = 629 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 11 VRQEMEMAP-RHSEWILDSTDNLHAFELSGPR 103 VRQE EMAP R+SEWI+DSTDNLHA ELSGPR Sbjct: 598 VRQEFEMAPHRNSEWIIDSTDNLHAVELSGPR 629