BLASTX nr result
ID: Ophiopogon26_contig00004793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00004793 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252528.1| uncharacterized protein LOC109829869 [Aspara... 62 3e-08 >ref|XP_020252528.1| uncharacterized protein LOC109829869 [Asparagus officinalis] ref|XP_020252529.1| uncharacterized protein LOC109829869 [Asparagus officinalis] ref|XP_020252530.1| uncharacterized protein LOC109829869 [Asparagus officinalis] gb|ONK76932.1| uncharacterized protein A4U43_C02F1380 [Asparagus officinalis] Length = 729 Score = 62.0 bits (149), Expect = 3e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 3 GRNKFNCQLSPEQVKDLCKLFQSEGKTINKKRPREVVRSETERI 134 GRNKF+C+LS EQVK+LCKLF+S GK KR REV+R+E E I Sbjct: 389 GRNKFSCELSVEQVKNLCKLFKSAGKISKSKRSREVIRAEPEPI 432